KEGG   Monodelphis domestica (opossum): 100019828Help
Entry
100019828         CDS       T01031                                 

Gene name
MAP2K4
Definition
mitogen-activated protein kinase kinase 4
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Toll-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
GnRH signaling pathway
Chagas disease (American trypanosomiasis)
Hepatitis B
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mdo04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:mdo04012]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:mdo04668]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:mdo04620]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:mdo04664]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:mdo04912]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mdo05166]
Human Diseases; Infectious diseases; Influenza A [PATH:mdo05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:mdo05161]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:mdo05169]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:mdo05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 391 aa AA seqDB search
MAAPSPSGGSGSGSPSAVGPPGPGHTAVSSMQGKRKALKLNFANPPFKSTARFTLNPSGV
QNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIM
AVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKF
YKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGNIKLCDF
GISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYP
KWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFIL
MYEERTVEVACYVCKILDQMPATPTSPMYVD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcggctccaagcccgagcggcggtagcgggagcggctctcctagcgccgtagggccc
cccgggccaggccacacggccgtcagcagcatgcagggtaaacgcaaagcattgaagctg
aattttgcaaatccacctttcaaatctactgcacggtttaccctgaatccttcaggagtc
caaaacccacacatagagagactgagaacacacagcattgaatcatcaggaaaactgaag
atctcccctgaacagcactgggatttcactgcagaggacttgaaagaccttggagaaatt
ggacgaggagcttatggttctgtcaacaaaatggtccacaaaccaagtgggcaaataatg
gcagttaaaagaattcggtctacagtggatgaaaaagagcaaaaacagctacttatggac
ttggatgtggtgatgcggagtagtgattgcccgtatattgttcagttttatggagcactc
ttcagagagggtgactgttggatctgtatggaactcatgtctacctcgtttgacaagttt
tacaaatatgtatatagtgtattagatgatgttattccagaagaaattttaggcaaaatc
acgttagcaactgtgaaagcactaaaccacttaaaagaaaacttgaaaattattcacaga
gacatcaaaccttctaatattcttctggatagaagtggcaatattaaactttgtgatttt
ggtattagtggacaacttgtggactccattgccaaaacaagagatgctgggtgcaggcca
tacatggcacctgaaaggatagacccaagtgcatcgaggcaaggatacgatgtccgttct
gatgtatggagtctggggatcacactgtatgaactggctacgggccgattcccttaccca
aagtggaacagcgtatttgatcagctgacacaagtagtaaaaggagaccccccacagctg
agtaattccgaggaaagggaattttccccaagcttcattaactttgtcaacttgtgcctt
acaaaggatgaatccaaaaggccaaagtataaagaacttctgaaacatccctttattttg
atgtatgaagaacgcacagtggaggttgcatgctacgtttgtaaaatcctggatcaaatg
ccagcaactcccacctctcccatgtatgttgattga

DBGET integrated database retrieval system