KEGG   Monodelphis domestica (opossum): 100019828Help
Entry
100019828         CDS       T01031                                 

Gene name
MAP2K4
Definition
(RefSeq) mitogen-activated protein kinase kinase 4
  KO
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Toll-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
GnRH signaling pathway
Chagas disease (American trypanosomiasis)
Hepatitis B
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Fluid shear stress and atherosclerosis
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100019828 (MAP2K4)
   04012 ErbB signaling pathway
    100019828 (MAP2K4)
   04668 TNF signaling pathway
    100019828 (MAP2K4)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100019828 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    100019828 (MAP2K4)
  Endocrine system
   04912 GnRH signaling pathway
    100019828 (MAP2K4)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100019828 (MAP2K4)
  Infectious diseases
   05166 HTLV-I infection
    100019828 (MAP2K4)
   05164 Influenza A
    100019828 (MAP2K4)
   05161 Hepatitis B
    100019828 (MAP2K4)
   05169 Epstein-Barr virus infection
    100019828 (MAP2K4)
   05142 Chagas disease (American trypanosomiasis)
    100019828 (MAP2K4)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100019828 (MAP2K4)
Protein kinases [BR:mdo01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100019828 (MAP2K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 391 aa AA seqDB search
MAAPSPSGGSGSGSPSAVGPPGPGHTAVSSMQGKRKALKLNFANPPFKSTARFTLNPSGV
QNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIM
AVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKF
YKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGNIKLCDF
GISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYP
KWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFIL
MYEERTVEVACYVCKILDQMPATPTSPMYVD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcggctccaagcccgagcggcggtagcgggagcggctctcctagcgccgtagggccc
cccgggccaggccacacggccgtcagcagcatgcagggtaaacgcaaagcattgaagctg
aattttgcaaatccacctttcaaatctactgcacggtttaccctgaatccttcaggagtc
caaaacccacacatagagagactgagaacacacagcattgaatcatcaggaaaactgaag
atctcccctgaacagcactgggatttcactgcagaggacttgaaagaccttggagaaatt
ggacgaggagcttatggttctgtcaacaaaatggtccacaaaccaagtgggcaaataatg
gcagttaaaagaattcggtctacagtggatgaaaaagagcaaaaacagctacttatggac
ttggatgtggtgatgcggagtagtgattgcccgtatattgttcagttttatggagcactc
ttcagagagggtgactgttggatctgtatggaactcatgtctacctcgtttgacaagttt
tacaaatatgtatatagtgtattagatgatgttattccagaagaaattttaggcaaaatc
acgttagcaactgtgaaagcactaaaccacttaaaagaaaacttgaaaattattcacaga
gacatcaaaccttctaatattcttctggatagaagtggcaatattaaactttgtgatttt
ggtattagtggacaacttgtggactccattgccaaaacaagagatgctgggtgcaggcca
tacatggcacctgaaaggatagacccaagtgcatcgaggcaaggatacgatgtccgttct
gatgtatggagtctggggatcacactgtatgaactggctacgggccgattcccttaccca
aagtggaacagcgtatttgatcagctgacacaagtagtaaaaggagaccccccacagctg
agtaattccgaggaaagggaattttccccaagcttcattaactttgtcaacttgtgcctt
acaaaggatgaatccaaaaggccaaagtataaagaacttctgaaacatccctttattttg
atgtatgaagaacgcacagtggaggttgcatgctacgtttgtaaaatcctggatcaaatg
ccagcaactcccacctctcccatgtatgttgattga

DBGET integrated database retrieval system