KEGG   Monodelphis domestica (opossum): 100019875Help
Entry
100019875         CDS       T01031                                 

Gene name
HDAC9
Definition
histone deacetylase 9
Orthology
K11409  
histone deacetylase 9 [EC:3.5.1.98]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100019875 (HDAC9)
  Substance dependence
   05034 Alcoholism
    100019875 (HDAC9)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100019875 (HDAC9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 1035 aa AA seqDB search
MSGQWALSDVGPAGPWRGLGKLWGPRTGVCGHDCLRAPADDGVAGREQLLAQQRMHSLIN
SVEVKSEVPVALDPVSPLDLRTDLRMMMPMVDPVLREKQLQQELLLIQQQQHLQKQLLIA
EFQKQHENLTRQHQAQLQEHIKLQQELLAIKQQQELLEKEQKLEQQRQEQEVERHRREQQ
LPPLRSKERGRERGVASTEVKQKLQEFLLSKSATKESPSNGKSHSASRHPKLWYTAAHHT
SLDQSSPPLSGTSPSYKYPLPGAQDAKDDFPLRKTASEPNLKVRSRLKQKVTERRSSPLL
RRKDGNVVTSFKKRVFEVTESSVSSSSPGSGPSSPSNGPATNMAESSETLLVPPAPHPEQ
MVSQQRLLIHEESMNLLSLYPSPSLPNITLGLPAVPSQLSASSSIKDKQKCEAPALRPPG
VTLPGQYTGSIPATSSHPHAALEGKPNSSHQALLQHLLLKEQMRQQKLLVTGGVPLHPQS
PLATKERVSPGLRGAHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQQV
HMNKPFLEPQPGHTLPTYQAQLAPIGTEGFDKHVLVSRARSSPAAPTLPHPATDRTLQRV
SETGLVYDALMLKHQCICGRSALHPEHAGRIQSIWSRLQETGLLSKCERIQGRKASLEEL
RLVHSDHHSLLYGTDPLSRQKLDPRMLRGDTSQKVFSLLPCGGLGVDSDTIWNELHSSAA
ARMAVGCVIELASKVVSGELKNGFAVVRPPGHHAEESTAMGFCFFNSVAITAKYLQEQFN
VAKILVVDLDVHHGNGTQQAFYADPSILYISLHRYDEGNFFPGSGAPNEVGSGPGEGYNV
NIAWTGGLDPPMGDAEYLAAFRTVVMPIAREFDPDIVLVSAGFDAVEGHTPPLGGYKVTA
KCFGNLTSQLMQVANGHVVMALEGGHDLTAICDASEACVNALLENELDPVPEDILHQTPN
RNAIASLQKTTEIQSKYWKSVERYSGGALTGTEEQEQEETETVSALASLSVDVDQCFPKE
DNRPAGEPMDEDPAL
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atgtctggccagtgggccctttccgatgtggggcccgcggggccttggcggggcctcggc
aagctctggggtccccgcaccggggtctgcgggcatgactgcctgcgtgcgcccgcagac
gatggggtggctggtcgggagcagctgttggctcaacagagaatgcacagcttgatcaac
tcagtggaggtgaagtcagaggttcccgtggctctggatcctgtctcgcccctggacttg
aggacggatctcagaatgatgatgcccatggtggatcccgtgctgcgggagaagcagctt
cagcaggagcttctcctcatccagcagcagcagcacctacagaagcaactgcttattgcc
gagttccaaaagcagcacgagaacctgacccgacagcaccaggcccagctacaggagcac
atcaagttgcaacaggaacttctagccataaagcagcagcaggaacttctggagaaggaa
cagaagttggagcagcagaggcaggaacaggaagtggagagacaccgccgagagcagcag
ctgccccctctgcgaagcaaagagagaggccgagaaagaggagtggcgagcactgaggtg
aaacagaagcttcaggagttcctgctgagcaagtcggccaccaaggagtctcccagcaac
gggaagagccattcggcgagccgccaccccaagctctggtacacggcggcccatcatacc
tccctagatcaaagctcaccgcccttgagtggaacctcaccgtcctacaagtacccatta
cctggagcacaagatgccaaggatgacttcccgcttcgaaaaaccgcctcagagcctaac
ttgaaggtgcgatcccgcttaaaacagaaagtgacagagaggagaagcagccccctactc
aggcggaaggatggaaatgttgtcacttcattcaagaaacgagtgtttgaggtgacagag
tcctcagtcagcagcagttctcctgggtcaggccccagttcgcccagcaatggacctgcc
accaacatggcagaaagcagcgagacattgcttgtgccacctgctccgcacccagagcaa
atggtttcacagcagcgtctcctgattcatgaagagtctatgaatcttttaagtctctat
ccatccccgtctttgcccaacataactctgggtctccccgccgtgccatcacagctcagt
gcttcatcttccatcaaagacaaacagaagtgcgaggccccggcactgaggccaccagga
gttactttgcctgggcagtacacgggaagcatcccagcaacttcaagtcatccccatgct
gccctagaaggaaaacccaatagtagccatcaggcactcctacaacacttgttactgaag
gagcagatgaggcaacaaaagctgcttgtgactggtggggttccgctccatccccagtcc
cctctggcaacaaaggagagagtatcacctggccttcgaggtgcccacaagttgcctcgc
cacaggcccctgaaccgtacccagtctgcccctttgccccagagcacattggcccagctg
gtcattcagcagcagcaccagcagttcctggagaaacagaaacagtaccagcagcaggtc
catatgaacaaaccattcttggagccccagcctggacacacactccccacgtaccaagct
cagctggcccccatcggcacagaaggctttgacaaacacgtcctcgtctccagggcccgc
tcttcccctgctgccccgacgctacctcacccagccacggatcggaccctccagcgtgtc
tcagagacgggcctagtgtatgacgctctgatgctgaagcatcaatgcatctgcggccgt
tctgcccttcatcctgagcatgctgggaggatccagagcatctggtcacgtctgcaagaa
actgggctcctgagcaaatgcgagcggatccaaggtcgaaaagcatctctagaagaattg
cgcctggtccattcagaccatcattctctgctctatggcactgatcccttaagcagacag
aagctggatccaaggatgctccgaggggacacgtctcagaaggtcttctccttgctgcct
tgtggtggacttggggtggacagtgacaccatttggaacgagcttcactcgtctgctgct
gcacgcatggctgttggctgtgtcatcgagctggcttccaaagtggtctcaggagagctg
aagaacgggtttgctgttgtcaggcccccaggccatcatgctgaagagtcaacagccatg
gggttctgcttttttaattcggtggccattaccgccaaatacttgcaggagcagttcaat
gtggccaagatattggttgtagacctggatgttcaccatgggaacggtacccagcaggct
ttttacgctgaccccagcatcctgtacatttccctccatcgctatgatgaaggcaacttc
ttccccggcagtggagccccaaatgaggttggaagtggccctggagagggatataatgtg
aatattgcctggacaggtgggctggacccccccatgggagatgcggagtatcttgcagca
ttcagaaccgtagtgatgccaattgccagagaatttgatccagatatagtccttgtctca
gctggatttgatgctgtggaaggccacacccctccattgggggggtacaaagtaacagca
aaatgttttggtaatttgacaagtcaactgatgcaagtggctaatggacacgtggtgatg
gctctggagggaggacatgatctcactgccatctgtgatgcatccgaagcctgtgtgaac
gctcttcttgaaaatgagctggatcctgtcccagaagatattctgcaccaaactccaaat
agaaatgccattgcttctctccagaagaccacggaaattcaaagcaagtactggaagtca
gtggagaggtattcaggtggtgctttaactggtactgaggaacaagaacaagaagaaaca
gagactgtctctgccctggcctccttgtctgtggatgtagaccagtgctttccaaaggaa
gataacagacctgctggcgagcccatggatgaagatccagccctgtga

DBGET integrated database retrieval system