KEGG   Monodelphis domestica (opossum): 100019898Help
Entry
100019898         CDS       T01031                                 

Definition
serine/threonine-protein phosphatase PP1-gamma catalytic subunit B-like
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mRNA surveillance pathway
cGMP-PKG signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Hippo signaling pathway
Focal adhesion
Platelet activation
Long-term potentiation
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Insulin signaling pathway
Oxytocin signaling pathway
Amphetamine addiction
Alcoholism
Herpes simplex infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100019898
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    100019898
   04022 cGMP - PKG signaling pathway
    100019898
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100019898
  Cell growth and death
   04114 Oocyte meiosis
    100019898
  Cell communication
   04510 Focal adhesion
    100019898
 Organismal Systems
  Immune system
   04611 Platelet activation
    100019898
  Endocrine system
   04910 Insulin signaling pathway
    100019898
   04921 Oxytocin signaling pathway
    100019898
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100019898
   04270 Vascular smooth muscle contraction
    100019898
  Nervous system
   04728 Dopaminergic synapse
    100019898
   04720 Long-term potentiation
    100019898
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100019898
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100019898
  Substance dependence
   05031 Amphetamine addiction
    100019898
   05034 Alcoholism
    100019898
  Infectious diseases
   05168 Herpes simplex infection
    100019898
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100019898
Protein phosphatases and associated proteins [BR:mdo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100019898
Transcription machinery [BR:mdo03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100019898
Spliceosome [BR:mdo03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100019898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 337 aa AA seqDB search
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNASRPVTPPRVTSGLNPSIQKASNYRNNTVLYE
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggcggatatcgataagctcaacatcgacagtatcattcaacggctgctggaagtgaga
gggtcgaagcctggtaaaaatgtccaactacaagagaatgaaatcagaggactgtgcttg
aaatcacgggaaatttttctcagtcagcctatcctgttagaacttgaagcaccacttaaa
atatgtggtgatattcatggacaatattatgatttacttcggctttttgagtatggtggt
ttcccaccggaaagcaactacctgtttctcggagattacgtggacagagggaagcagtcc
ttagaaacaatttgccttctactggcctacaaaatcaaatacccagagaatttttttctt
cttagagggaaccatgaatgtgccagcatcaatagaatttatggattttatgatgaatgt
aaaagaagatacaacattaaactatggaaaacctttacagactgctttaattgcttacca
attgcagccattgtggatgagaaaatattctgctgtcatggaggcttatccccagatctt
cagtccatggagcagattcggcgaattatgcgaccgactgatgtacctgaccaaggcctt
ctttgtgatctcttgtggtctgaccctgataaagacgtcttaggctggggtgaaaatgac
agaggcgtgtccttcacatttggggctgaagtggttgccaaatttctccataaacatgat
ttggatcttatatgtagagcccaccaggtggttgaagatggatatgaattttttgcaaag
aggcaattggtaacactcttttctgccccaaattattgtggtgaatttgacaatgcaggt
gccatgatgagtgtggatgaaaccctaatgtgttcttttcagattctgaagcctgctgag
aagaagaagcccaatgccagcagacctgtcacgccaccacgggttacatcaggcctgaac
ccgtccattcagaaagcttcaaattatagaaacaatactgttctttacgagtga

DBGET integrated database retrieval system