KEGG   Monodelphis domestica (opossum): 100019909Help
Entry
100019909         CDS       T01031                                 

Gene name
UCHL5
Definition
ubiquitin carboxyl-terminal hydrolase L5
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100019909 (UCHL5)
Peptidases [BR:mdo01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100019909 (UCHL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 329 aa AA seqDB search
MAGSAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQP
GEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQS
FDAAMKGLALSNSEVIRQVHNSFARQQMFEFDAKTSAKEEDAFHFVSYVPVSGRLYELDG
LREGPIDLGACNQEDWINAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQR
QLAEEEPMDTDQSTNMLSTIQSEVAKHQMLIEEEIQKLKRYKIENIRRKHNYLPFIMELL
KTLAEHQQLIPLVEKAKEKQNAKKAQETK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcagcgccggggagtggtgcctcatggagagcgaccccggggtcttcactgaa
ctcattaaaggattcggttgtcgaggtgcacaagtagaggaaatatggagtctggagcca
gagaattttgagaaattgaagccagttcatgggttaatttttcttttcaagtggcagcct
ggagaagaaccagcaggctctgtggttcaggattccagacttgacacaatattttttgca
aaacaggtaataaataatgcttgtgcaactcaggccatagtcagtgtattattgaattgt
acccatcaagatgtccatctaggggagacactttcagaatttaaagaattttcacaaagt
tttgatgctgcaatgaaaggtttggcattaagcaactcagaagtgatccgacaagttcac
aacagttttgccagacaacagatgtttgaatttgatgcaaaaacatcagcaaaagaagaa
gatgcttttcattttgttagttatgttcctgtcagtggaagactatatgaattagatgga
ttaagagaaggaccaattgatttaggcgcatgtaatcaagaagattggattaatgcagta
agaccagttatagagaaaagaatacaaaaatacagtgaaggtgaaatacgatttaacctg
atggccattgtgtccgacagaaagatgatatatgagcagaagatagctgagttacaaaga
cagcttgcagaggaggaacctatggatacagatcagagtactaatatgttaagtaccatt
caatcagaagttgccaaacatcagatgctaattgaagaagaaattcagaaattaaaaaga
tacaagattgaaaatattagaagaaagcataattatctgcctttcatcatggaactatta
aagactttagcagaacaccagcaattaataccattagtagaaaaggcaaaagaaaaacag
aatgcgaagaaagctcaggaaaccaaataa

DBGET integrated database retrieval system