KEGG   Monodelphis domestica (opossum): 100020230Help
Entry
100020230         CDS       T01031                                 

Definition
protein disulfide-isomerase TMX3-like
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 546 aa AA seqDB search
MASGLGALKATSHCSFSLPLGLLMTYRAQSSEGFWDLKVDLGLRSERGTVVVVWGGLLLA
CAGVSLVQSCCGLCLPLSPLALTAVIELSEKYPGVHRKTVDLQRDTSFFPAQEICLFSLS
PSWKKFKDNRKNSIWLVDFYAPWCAHCRRLEPVWNEVGLEMRKLQSPVKVGKMDATSYTS
IASEFGVRGYPTIKLLKNDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFEHVKKR
HRVLFLYVGGESPLKEKYIEVASELIVYTYFFSASEEVIPEYVTLNEMPAVLVFKDETYF
VYDEYEDGDLKSWVNRERFQSYLTVDGFTLYELTDTGKLIIIAVIDGKNATIEHTRMKEF
VQEVAKDYRNRFHRDFQFGHIDGTDYVNNMLMEELNVPTVVIINTSNHQYYLPTRHIETL
EDVMQFINDILDGTIEGRGGDGILQRLKRIFYDIRTTVVSVFRSSPFLGCFLFGLPLGVI
SIMCYGIYTADTDVAYTEERIEVSKTEIETRDENNEEEKKEENNENSLVLSDAEQEPKDI
MEKKND
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgggctaggagctctgaaagccacctcacattgctcattcagtctccccctg
ggactgttgatgacatacagagctcaaagcagtgaagggttttgggatctcaaagttgac
ttgggcctgcgttcagagcgtggaacagtagttgtggtgtggggaggcttgctgttggct
tgtgctggtgtttccttggtgcagtcttgctgtgggctgtgcttgcctctcagcccattg
gctcttactgctgtgattgagctgagtgagaagtatccgggggttcacaggaaaacagtt
gatctccagagagacaccagcttcttcccagctcaggagatctgcctcttctctctgtct
cccagctggaagaaatttaaagacaatcggaaaaatagcatttggcttgtagatttctat
gcgccatggtgtgcacactgcagaagactggaaccagtttggaatgaagttggtttagag
atgagaaagcttcagtctccagttaaagttggaaagatggatgctacttcctatactagc
attgcttcagagtttggagttagaggatatccaacaattaagctgttaaaaaatgacctg
gcatataactaccgagggcctagaactaaagatgatatcattgaatttgctcatagagtg
tctggggctctaatccgtccacttccaagtcaacagatgtttgagcatgtgaagaagagg
catcgtgtactatttctttatgttggaggagagtcacctttaaaggagaaatacatagaa
gttgcttcagaattaattgtttatacctacttcttctcagcctcagaagaggttatacct
gagtatgtaaccctgaatgagatgcctgctgttcttgttttcaaagatgaaacttatttt
gtatatgatgaatatgaagacggagatcttaaatcctgggtcaacagagagcgatttcag
agttatcttactgtggatggctttaccctctatgaacttacagacacaggaaaacttatt
atcatagcagttattgatgggaaaaatgcaacaattgaacatacaagaatgaaggaattt
gttcaagaagtagctaaagattatagaaatcgttttcacagagattttcagtttggacac
atagatggaactgactatgtaaataacatgctgatggaagaattgaatgttccaactgta
gttataataaatacttcaaaccatcagtattacctgccaactagacatattgagactctt
gaagatgtgatgcagttcattaatgatattttggatggcacaatagaaggccgaggtggt
gatggaattttgcagagattgaaaagaatattttatgatattaggactactgttgtgtct
gtattcagaagctcaccatttttgggctgctttctctttggcctgccactgggtgtcatc
agtatcatgtgttatggaatctacacagctgacacagatgtagcttatacagaagaacga
attgaagtatctaaaacggaaattgaaactcgagatgaaaacaatgaggaagaaaaaaag
gaagaaaacaatgaaaattctctagtactttcagatgcagagcaagaacccaaagatata
atggaaaagaaaaatgactga

DBGET integrated database retrieval system