KEGG   Monodelphis domestica (opossum): 100020463Help
Entry
100020463         CDS       T01031                                 

Gene name
TESK1
Definition
testis-specific kinase 1
Orthology
K08841  
testis-specific kinase 1 [EC:2.7.12.1]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100020463 (TESK1)
Protein kinases [BR:mdo01001]
 Serine/threonine protein kinases: TKL group
  LISK family [OT]
   100020463 (TESK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 816 aa AA seqDB search
MEVRPREEAEKEAQGREAPGGKELSGGRAPPPAGRSAGAQPEPEPEPKPEPEKGDGGGGG
LGACHPPGERARPPVRRLGIVRPARTPGLSLGGGRSAADGRSGPVPGCQLRGRTRDSRDP
PDSPDLWAPSPCAAPPPLGRLPRAVSPSSLRPRREAPAGSLGPQRCEPEAHGPAMAGERP
PLSGPGPGPGPGEGPGEAGGEGPPAPGGGGRPSSYRALRSAVSSLARVDDFHCAEKIGAG
FFSDVYKVRHRQSGQILVLKMNRLPSNRGNTLREVQLMNRLRHPNILRFMGVCVHQGQLH
ALTEYINGGTLEQLLSSSEPLTWPARLGLALDIARGLRYLHAKGVFHRDLTSKNCLVRRE
EEGLTAVVGDFGLAEKIPVYREGARKEPLAVVGSPYWMAPEVLRGELYDEKADVFAFGIV
LCELIARVPADPDYLPRTEDFGLDVAAFRALVGEDCPPPFLLLAIHCCSMEPSSRAPFTE
ITQHLEHILEQLPGPQSLVKPVRSAPTQAPAPRDGAPPAPPQHLPLPPDPRLARSRSDLF
LPPSPGLLPCWGDSQTRVNPFSQREDLWGGRIKLLDTPSRRAVPLLPLPTATPSPVTTPE
PLVQPPYPRPLPGTPARRCRSLPSSPELPRRMETALPGPGPPPSGPFSEDRMDCGGSSPE
TEPPGPRPAPLPAAVNDNFISTCSSASQLWSSRAGPSPGLLLNNNPSPVVVSSPPGWGGQ
PWGRAQRSLPQATALERTEPAPLPPTVAPRDPEEGLPCPGCCLGPFSFSFLSVCPRPTPA
VARYRNLNCEAGSLLCHRGHHAKPPTPGLQLPGARS
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atggaggttagacctagggaggaggctgagaaggaggctcaagggcgggaggctccgggc
gggaaggagttaagcggaggccgggccccgccccccgcaggccgcagcgccggagcccag
ccggagccggagcccgagccgaagcccgagccggagaaaggggacggcggcggcggcggc
ctcggagcctgccatcccccgggggagcgagcccgccctcccgtccggcgcctggggatt
gtcaggccggcccgaaccccgggcctgagcctcggaggcgggcggagcgcagcggacggc
agatccggcccggtcccgggctgccagctccgggggcggacccgggattcccgggatccc
ccagattccccagatctctgggccccaagtccctgcgccgccccgcctcccctgggccgg
ctcccccgcgccgtctccccctccagcctccggcctcgccgagaggcccctgccgggtct
ctagggccccagcgatgtgaaccagaggcgcacggtccggccatggccggagagcggccc
ccgctgagcggccctgggcccgggccggggccaggagaagggcccggggaggccgggggg
gaggggcccccggcgcccgggggcgggggccgcccctcctcctaccgagcgctccgcagc
gcggtgtccagcctggcccgagtggacgactttcactgcgcggagaagatcggggccggc
ttcttctccgacgtgtacaaggtccgccaccgacagtctggacagatccttgtgctgaag
atgaaccggcttcccagtaaccgaggaaacacacttcgggaggtgcaactcatgaaccga
cttcggcaccctaacatcctgcggttcatgggggtctgcgtgcatcaagggcagcttcac
gccctaactgagtatattaatgggggaaccctggagcagctcctcagctcctcagagcct
ctgacctggccagctaggctcggcctggccctggacattgcgaggggcctccgctatcta
catgctaagggggttttccatcgggaccttacctccaagaactgcctggtacgtcgggaa
gaggagggccttacagctgtggtgggtgactttggactggcagaaaagatccctgtgtac
agggagggggcaaggaaggaaccattggctgtggttggctccccatactggatggcacct
gaggtacttcggggagaactatatgatgagaaggctgatgtctttgcctttgggattgtc
ctgtgtgaactcattgcccgggtccctgctgaccctgactacttgccccgaactgaggat
tttggcctggatgttgctgctttccgtgccctggttggagaggactgccccccacccttc
ctcctcttggccatccactgctgtagtatggagcccagctcccgagcccccttcactgag
atcacacagcatctggagcatatcctggagcagttacctgggccccagagcctggtgaaa
ccagtccgctctgccccaacccaggcgcctgccccaagagatggtgcacctcctgctcct
cctcagcacttgccactgccccctgacccccggcttgctcggagccgctcggacctattc
ctgccaccgtccccggggctgctgccctgttggggggatagccagaccagagtgaacccc
ttctcccagagggaagacctctggggtggcagaatcaagctcttggacactcctagcaga
agggccgtccccctgttgccactgcccacggccaccccaagtccagtgaccacgcctgag
cctctggtccagccaccttacccccggcccctgccaggaacccccgcccggagatgccgc
tccctcccctcctccccagagctgcctcgaaggatggagacggctctgcctgggcctggc
ccgcccccctcgggccccttctcggaggacaggatggactgtgggggcagcagccccgaa
acagagcccccggggccgaggcccgccccgctccccgccgcagtcaacgacaattttatc
agcacctgttcctcggcctcccagctctggtcctcccgggcagggccttccccgggactc
ctgctcaacaacaacccttcgcctgtggtcgtgagctcccccccaggctggggtggccag
ccctggggcagagctcagcgcagcctgccccaggccacagccctggagcggactgagcct
gcccccctgccccccaccgtggcccccagggaccctgaggaggggctgccctgccctggc
tgttgccttggccccttcagcttcagtttcctgtctgtgtgcccccggccgacacctgct
gtagcccgctaccgcaatctgaactgtgaggctggcagtctcctctgccaccgagggcac
catgccaagccacccacgcccggcctgcagctgcccggagcccgctcctag

DBGET integrated database retrieval system