KEGG   Monodelphis domestica (opossum): 100020463Help
Entry
100020463         CDS       T01031                                 

Gene name
TESK1
Definition
testis-specific kinase 1
Orthology
K08841  
testis-specific kinase 1 [EC:2.7.12.1]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 647 aa AA seqDB search
MAGERPPLSGPGPGPGPGEGPGEAGGEGPPAPGGGGRPSSYRALRSAVSSLARVDDFHCA
EKIGAGFFSDVYKVRHRQSGQILVLKMNRLPSNRGNTLREVQLMNRLRHPNILRFMGVCV
HQGQLHALTEYINGGTLEQLLSSSEPLTWPARLGLALDIARGLRYLHAKGVFHRDLTSKN
CLVRREEEGLTAVVGDFGLAEKIPVYREGARKEPLAVVGSPYWMAPEVLRGELYDEKADV
FAFGIVLCELIARVPADPDYLPRTEDFGLDVAAFRALVGEDCPPPFLLLAIHCCSMEPSS
RAPFTEITQHLEHILEQLPGPQSLVKPVRSAPTQGTGKXIRGMIYGAPPAPPQHLPLPPD
PRLARSRSDLFLPPSPGLLPCWGDSQTRVNPFSQREDLWGGRIKLLDTPSRRAVPLLPLP
TATPSPVTTPEPLVQPPYPRPLPGTPARRCRSLPSSPELPRRMETALPGPGPPPSGPFSE
DRMDCGGSSPETEPPGPRPAPLPAAVNDNFISTCSSASQLWSSRAGPSPGLLLNNNPSPV
VVSSPPGWGGQPWGRAQRSLPQATALERTEPAPLPPTVAPRDPEEGLPCPGCCLGPFSFS
FLSVCPRPTPAVARYRNLNCEAGSLLCHRGHHAKPPTPGLQLPGARS
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggccggagagcggcccccgctgagcggccctgggcccgggccggggccaggagaaggg
cccggggaggccgggggggaggggcccccggcgcccgggggcgggggccgcccctcctcc
taccgagcgctccgcagcgcggtgtccagcctggcccgagtggacgactttcactgcgcg
gagaagatcggggccggcttcttctccgacgtgtacaaggtccgccaccgacagtctgga
cagatccttgtgctgaagatgaaccggcttcccagtaaccgaggaaacacacttcgggag
gtgcaactcatgaaccgacttcggcaccctaacatcctgcggttcatgggggtctgcgtg
catcaagggcagcttcacgccctaactgagtatattaatgggggaaccctggagcagctc
ctcagctcctcagagcctctgacctggccagctaggctcggcctggccctggacattgcg
aggggcctccgctatctacatgctaagggggttttccatcgggaccttacctccaagaac
tgcctggtacgtcgggaagaggagggccttacagctgtggtgggtgactttggactggca
gaaaagatccctgtgtacagggagggggcaaggaaggaaccattggctgtggttggctcc
ccatactggatggcacctgaggtacttcggggagaactatatgatgagaaggctgatgtc
tttgcctttgggattgtcctgtgtgaactcattgcccgggtccctgctgaccctgactac
ttgccccgaactgaggattttggcctggatgttgctgctttccgtgccctggttggagag
gactgccccccacccttcctcctcttggccatccactgctgtagtatggagcccagctcc
cgagcccccttcactgagatcacacagcatctggagcatatcctggagcagttacctggg
ccccagagcctggtgaaaccagtccgctctgccccaacccagggtacgggaaaataaatc
agggggatgatatatggtgcacctcctgctcctcctcagcacttgccactgccccctgac
ccccggcttgctcggagccgctcggacctattcctgccaccgtccccggggctgctgccc
tgttggggggatagccagaccagagtgaaccccttctcccagagggaagacctctggggt
ggcagaatcaagctcttggacactcctagcagaagggccgtccccctgttgccactgccc
acggccaccccaagtccagtgaccacgcctgagcctctggtccagccaccttacccccgg
cccctgccaggaacccccgcccggagatgccgctccctcccctcctccccagagctgcct
cgaaggatggagacggctctgcctgggcctggcccgcccccctcgggccccttctcggag
gacaggatggactgtgggggcagcagccccgaaacagagcccccggggccgaggcccgcc
ccgctccccgccgcagtcaacgacaattttatcagcacctgttcctcggcctcccagctc
tggtcctcccgggcagggccttccccgggactcctgctcaacaacaacccttcgcctgtg
gtcgtgagctcccccccaggctggggtggccagccctggggcagagctcagcgcagcctg
ccccaggccacagccctggagcggactgagcctgcccccctgccccccaccgtggccccc
agggaccctgaggaggggctgccctgccctggctgttgccttggccccttcagcttcagt
ttcctgtctgtgtgcccccggccgacacctgctgtagcccgctaccgcaatctgaactgt
gaggctggcagtctcctctgccaccgagggcaccatgccaagccacccacgcccggcctg
cagctgcccggagcccgctcctag

DBGET integrated database retrieval system