KEGG   Monodelphis domestica (opossum): 100020904Help
Entry
100020904         CDS       T01031                                 

Gene name
USP16
Definition
ubiquitin specific peptidase 16
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100020904 (USP16)
Peptidases [BR:mdo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100020904 (USP16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 814 aa AA seqDB search
MGKKRTKGKTVLADDDSEILEPRCRHIKKGLEQSGLKKSLMNVQWNVCQECKIDNRTNDK
PEGENKENPSIWLCLKCGHQGCGRYSQEQHALKHYTTPRSEPHCLVLSLYNWSVWCYLCD
EEVQYSSSDRLGQLVDYIRKQINVKTSRQASKEQGKAEIENKKLEKDSKNEQEREKKENM
TKENSPLNAAAHMTVKGLSNLGNTCFFNAVMQNLSQTLVLRELLKEVKMSGTIVKIESPD
LSLTEPLEINLGPPGPLTSAMCQFLNEMHETKRGIVTPKELFSQVCKKAVRFKGFQQQDS
QELLRYLLDGMRAEEIQRVSAGILTALGSPTGKPDEDLRRRIKEHERKKSMPSFVDRIFG
GELTSTIMCEQCKTVSLVHESFLDLSLPVLDDQSGKNINDKNIKKTKEDESKDSEEEKDN
NIYMKKNTIPPYTSKHWQKKAKKQAKKLAKNQRRQQKMQEKTIQLNNLCMNDKPEEHPHV
TDALPEEETDDDSNSFSQEEEKCQESCSNQEDISDRESPVEALPGNAGEADLPRAAFSIE
RAGDFNGASLGGDSEDEEDLAGDLGHLQLDPLLEPDEGNGELLNDGCPVGAKIYEVVHDV
PETAFCTLAPREAADTDEGSIHHCLYQFTSNEKLQGSNKLLCDVCTQRQRPGPKAHSKGE
KKCVYTDAKKQMLISQAPPILTLHLKRFQQAGLNLCKVNKHIKFPDVIDLAPFCTIKCKN
VAEGNTKVLYSLYGVVEHSGTMRWGHYTAYVKTRTSNSHLYNLVLDGTSPQEFENESTKG
QWFHISDTHVQAVPASKVLNSQAYLLFYERILNN
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaaacgtacaaagggaaaaactgtactggctgatgatgattctgaaatttta
gaacctcgatgcagacatattaaaaaaggattagaacaaagtggtttgaaaaagtctttg
atgaatgtgcaatggaacgtttgccaagaatgcaagattgacaacaggacaaatgataaa
cctgaaggggagaataaagaaaacccttcaatctggctgtgtcttaaatgtggccatcag
ggttgtggcagatattctcaagaacagcatgctttgaagcattatacgacaccaagatca
gaaccccactgtttggttcttagtttgtacaactggagtgtgtggtgttacttgtgtgat
gaggaggtccaatatagcagctcagatcgattgggtcaacttgtggattatattagaaaa
caaatcaatgtcaaaacttcaagacaagcatcaaaagaacaagggaaagctgaaattgaa
aataaaaaattagaaaaagacagtaaaaatgaacaggagagagagaaaaaggaaaacatg
acaaaagaaaattctccattgaatgctgctgctcacatgactgtgaaaggactcagtaat
ttggggaatacgtgtttctttaatgcagttatgcagaatttgtcacagacactagtacta
agagaactgttgaaagaagtaaaaatgtctggaacaatagtgaaaattgaatcacctgat
ttgtccctaacagaacctctagaaataaaccttgggcctccaggacctcttacttcagcc
atgtgccaatttcttaatgagatgcatgaaaccaagaggggaattgtgacacccaaagag
ctattttctcaggtctgtaaaaaagcagtgcgatttaaaggctttcagcagcaagatagt
caggagctgcttcggtatctcttagacggaatgagagcagaagaaatccagagagtgagc
gccggcatccttacagcgctgggcagccccaccggaaagccggacgaagacctgagaagg
aggattaaagagcatgaaagaaagaagtccatgccgagctttgtggatcgaatattcggg
ggcgagctgacgagcacgatcatgtgtgagcagtgcaaaaccgtctcgttggttcacgaa
tccttccttgatttgtctctccccgttttagatgatcagagtgggaaaaacataaatgat
aaaaatatcaaaaaaacaaaagaagatgaaagtaaagacagtgaagaagagaaagataac
aatatttatatgaaaaagaatactattcctccttatacaagtaagcactggcagaaaaaa
gcaaagaagcaagccaaaaagctggcaaagaaccaacgaaggcaacagaaaatgcaagaa
aagacgattcagctcaataacctctgtatgaatgacaagcctgaagaacatccgcacgtt
actgacgctttgccagaggaggagacagacgatgactccaacagcttctcacaagaggaa
gaaaagtgtcaagagtcctgctccaatcaggaagacataagcgacagggagagccccgtg
gaagctctgcccggaaatgcaggcgaggccgacctccctcgtgctgccttttccatcgag
cgtgccggggacttcaatggcgcgtctctcgggggggacagcgaggacgaggaggacctc
gccggggacctcggacatctccagctggacccgcttctggaacctgatgaagggaacggg
gagctcttgaacgacggctgtcccgtcggggcgaagatctacgaagtagtccacgacgtt
ccagagactgctttttgtaccctcgctcccagggaagctgcggacacggacgaaggctcc
atccatcactgcttgtatcagttcactagtaacgagaagctgcagggttccaacaagctg
ctttgtgacgtttgcacccagaggcagcggcctggaccaaaggcgcacagtaaaggcgaa
aagaagtgtgtttacacggacgccaagaagcagatgctgatctctcaggctcctcccatc
ctaactcttcacctaaagaggtttcaacaggctggtctgaatctatgcaaagttaacaag
cacataaagtttccagatgtgatagatttggctccgttttgtaccataaagtgtaagaat
gttgctgaaggaaatacaaaagtattgtattctttatacggagttgttgaacacagtggt
actatgaggtggggacattatactgcctatgtgaagacaagaacttcaaatagtcatctt
tataatcttgttcttgatggaactagtccacaagaatttgaaaatgaatcaacgaagggg
cagtggtttcatatcagtgatacacatgtacaagctgtgcctgcatctaaggttctaaat
tcacaagcttacctcctgttttatgagcgaatacttaataattaa

DBGET integrated database retrieval system