KEGG   Monodelphis domestica (opossum): 100021067Help
Entry
100021067         CDS       T01031                                 

Gene name
USP4
Definition
ubiquitin specific peptidase 4 (proto-oncogene)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 965 aa AA seqDB search
MAEGGGCGQRPDAETQKSELGALMRTALQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVG
ENNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLVNWYGCVEGQQPIVRK
VVEHGLFVKHCKVEVYLLELKLCENSDPTNMLSCHFSKADTIATIEKEMRKLFNIPDERE
TRLWNKYMSNTYEQLSKPDNTVQDAGLYQGQVLVIEPQNEDGTWPRQTLQSKSSTSRAFT
TSPKSAASSYSSMSASPITNGDSANSSGVHSSGLSRGGSGFSNSYSCRESQSHTQPGLCG
LGNLGNTCFMNSALQCLSNTAPLTEYFLKDKYEAEINRDNPLGMKGEIAEAYAELIKQMW
SGRNTQVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLELKDA
NGRPDLVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECSKISVTFDPFCYLTLPLPL
KKDRTMEVFLVSADPQCRPTQYRVTVPMMGAVSDLCEALSKLSGIAAENMVVTDVYNHRF
HKIFQMDEGLNHIMTRDDIFVYEVCNTAEDGSECVTFPVYFRERKIRQTSSSSGTVLYGQ
PLLISVPKHKLTLDYLYQVICERISRYIKHPLPDDSPRPHLDSATYNGSNGICEGEEEEM
EHQDDSKGQATETESCSTEDCSEHELGNESCQNVPKRVRSQHCKKRLFTFSLVNSYGTTD
INSLAADGKLLKLNSRSTVAVDWDTETRCLHYDEQESEAYDKHSSMLQPQKKKKTTVALR
DCIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKVLVVHLKRFSYNRYWRDKLD
TVVEFPIRDLHMSEFVCDPAAGPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDD
SNVSLASEDQIVTKAAYVLFYQRRDDEFYKAPSLPGYSGPSDAGKKGKRSQEGLEEDDLY
SMDTN
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggcggaggctgcgggcagcggccggacgcggagacccagaaatctgagctc
ggggccctgatgaggacggcgcttcagcgaggggcacagtggtatctgattgacagccga
tggttcaagcagtggaagaaatatgtgggctttgatagctgggatatgtacaatgtgggt
gaaaacaacttgtttcctggcccaatagataactccggacttttttcagatcccgaaagt
caaaccttaaaggagcatttaattgatgaactagactatgtattggttcctactgaagcc
tggaataaattagtgaattggtatggctgtgtagaagggcaacagcccatagtcagaaaa
gttgtggaacatggcctgtttgtcaaacactgcaaagtagaggtttatttgctggaactg
aagctctgtgaaaacagtgaccccaccaatatgctgagttgccatttcagcaaagccgat
accatagcaaccattgagaaggaaatgcggaaactatttaacattcctgatgagagggaa
accaggttatggaacaaatatatgagtaatacatatgagcagctcagcaagccagacaac
actgtgcaagatgctggtttataccaggggcaggtactagtcattgagccccaaaatgaa
gatggcacatggcctaggcagacacttcagtccaaatcaagcactagcagagcttttact
acctctccaaaatcagcagcaagctcctattcctccatgtctgcttctcccattacaaat
ggtgatagtgctaactcttctggcgtgcacagctccggtctcagcaggggaggttctggc
ttctccaattcttatagttgccgagagtctcaatctcacactcaacctgggctttgtgga
cttggaaacctggggaacacctgcttcatgaattctgctttgcagtgcttgagtaacact
gcaccattgacagaatactttctaaaagataaatatgaggctgaaatcaatcgagataat
cctctgggcatgaaaggggaaatagctgaggcttatgctgaactcatcaaacagatgtgg
tctgggaggaacacacaggttgccccacggatgttcaaaacccaagttggtcgttttgcc
cctcagttttccggttaccagcaacaggattctcaagagttattagcctttcttctagat
ggattgcatgaagatctaaaccgtgtgaagaagaaaccatacttggagctaaaagatgcc
aacggccggcctgacttggtggtggcaaaggaagcatgggagaatcacaggttaaggaat
gattctgtgatagtggacacatttcatggccttttcaaatctacattggtctgcccagaa
tgttctaaaatttctgtgacttttgacccattctgttatttaactctccctttgcccctg
aagaaagatcgcactatggaggtgttcttggtctctgcagatccacagtgtagacctacc
cagtatcgtgtgactgtaccaatgatgggcgctgtgtctgatctgtgtgaggctctctca
aagctctccggcatcgctgctgaaaatatggtggtcacagatgtgtataatcatcggttc
cacaaaattttccaaatggatgaaggtttaaatcatattatgacccgggatgacatcttt
gtatatgaagtctgcaacacagcagaggatggatcagaatgtgtcacctttccagtttac
ttcagagagaggaaaatcaggcagacaagctcatcttctgggactgttctatatgggcaa
ccattgctaatctctgtcccaaagcacaagttaacccttgactacttgtaccaggttatc
tgtgagcgtatcagccgctacataaaacatcctttaccagatgactctcctagaccacac
ttggacagtgctacctataatggttccaatggcatttgtgaaggagaagaagaagaaatg
gaacaccaagatgatagcaaaggacaagctacagagacagagtcctgttcaactgaagac
tgttctgaacatgaattgggaaatgagtcctgtcagaatgtcccaaagagagtcagaagc
cagcactgcaaaaaaaggcttttcaccttcagcctggtgaattcctatggcaccactgac
atcaattctcttgcagcagatgggaagctcctcaaactgaattctcgttccacagttgct
gttgattgggacaccgaaacccggtgtcttcactacgatgaacaagagtcagaggcttat
gataaacacagcagcatgctccagccccagaagaagaagaaaacaacggtggcccttcga
gattgcattgagctcttcactaccatggaaaccctgggggagcatgatccctggtattgt
cctaactgtaagaaacatcaacaggccacgaagaaatttgacttgtggtccttgccaaag
gtattggtggttcacctcaagcgattttcatacaacagatactggagagataaacttgac
actgtggttgaatttccaataagagacctgcatatgtccgagtttgtctgtgacccagca
gctggcccttatgtctatgacctcattgctgtatccaatcattatggagccatgggtgtg
ggtcactatactgcatatgcaaaaaacaaactaaatggcaaatggtattactttgatgat
agtaatgtatccctggcctctgaggatcaaatagtgacaaaagcagcatatgtgttgttt
taccagcgtcgggatgacgagttttataaggcaccctccctcccaggttactctggtccc
tcggatgcagggaagaaaggaaaacgctcccaggagggactggaggaggatgacttgtat
agcatggataccaactga

DBGET integrated database retrieval system