KEGG   Monodelphis domestica (opossum): 100021302Help
Entry
100021302         CDS       T01031                                 

Gene name
STAMBPL1
Definition
STAM binding protein-like 1
Orthology
K11867  
AMSH-like protease [EC:3.4.19.12]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100021302 (STAMBPL1)
Peptidases [BR:mdo01002]
 Metallo Peptidases
  Family M67
   100021302 (STAMBPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 415 aa AA seqDB search
MRLPLRALLQPPGTLPSSSFEEVINNAAADSLGLKIAGAALHKAAGQRETSRKFLKRERE
HHLFVEKLPGHRDYRQCAIPEKQDIMKKLKEVAFPRTDELKKDLLRKYSVEYQECLQSQD
RYNADFPQRLEQQRLIEAEKRRIAQMRQQQLETEQFQFFEDQLKKQELARDQLRGPDAPA
MLAEQIDGNALPCFPRRPGVCPDQSPKSDPGQSPPVTRALKPAATLSAVHNLVVEGLRCV
LLPRDLCPRFLLLAESNTVRGIETCGILCGKSGTFLCAGRTHNEFAITHVIVPKQSAGPD
YCDVANVEELFSVQDQHSLLTLGWIHTHPTQTAFLSSVDLHTHCSYQLMLPEAIAIVCAP
KHKDTGVFRLTNAGMLEVSACKKKGFHPHTKDPRLFSTCQHVVDQDRSITLLDLR
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgcctctaagagcgcttctgcagccacctggcaccctccccagctcctccttt
gaggaagtgattaataatgctgctgccgactccctgggactaaaaatagccggggctgct
ctgcataaggctgcagggcagcgagagacttcccggaaatttctgaagcgcgaaagagaa
catcacctgttcgtggagaagctgcccggccaccgcgactaccggcaatgcgccatcccg
gagaagcaggacatcatgaagaaactcaaggaggtcgccttcccgaggacggacgagctg
aaaaaggatcttttaaggaaatatagcgtagagtaccaagaatgcttgcaaagccaagac
cgctacaacgccgacttcccccagaggctagagcagcagcgccttatcgaggcggagaag
aggcgtatcgcccagatgcggcagcagcagctggagaccgagcaattccagttctttgag
gaccagctcaagaagcaggagctggcgcgggaccagctgcgcggccccgacgccccggcc
atgctagccgaacagatcgacggcaacgcgctgccctgcttcccgcggcggcccggtgtc
tgccccgaccagtccccgaagagtgacccgggccagtccccgccggtcaccagagccctg
aagcccgctgccacgctgagcgccgtgcacaacctggtggtggagggtcttcgatgtgtc
ctgttgcccagggatctttgcccccgcttcctgctgctggctgagtcaaacacagtgagg
gggatagaaacctgtggaattctctgtggaaaatctggtacgttcctctgtgcaggcagg
acccataatgagtttgccatcacccacgttattgtgccaaagcagtcagctggcccagac
tactgtgacgtagccaacgtggaagagctcttcagcgtccaggaccagcacagccttctg
accctgggatggatccatacacacccaacgcagacggcattcctgtcgagtgtggacctt
cacacccactgctcctaccagctcatgctgccagaggccatcgctatagtctgtgcaccc
aaacataaggacaccggtgtcttcaggctcaccaatgcaggcatgctggaggtctctgct
tgtaaaaagaagggcttccatcctcataccaaggatcccaggctcttcagtacctgccag
catgtggtggaccaagatcgcagcatcacactgctggatctcaggtga

DBGET integrated database retrieval system