KEGG   Monodelphis domestica (opossum): 100021325Help
Entry
100021325         CDS       T01031                                 

Definition
(RefSeq) alpha-galactosidase A-like
  KO
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100021325
  Lipid metabolism
   00561 Glycerolipid metabolism
    100021325
   00600 Sphingolipid metabolism
    100021325
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    100021325
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100021325
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     100021325
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 454 aa AA seqDB search
MFAFAALTLVLLGGPGITALDNGLALTPTMGWLPWERFTCNVNCIQDPENCISEQLFMQM
ADLMVSEGWKDAGYEYVCIDDCWLASKRNKDGTLKADPKRFPSGIRHLANYVHSRGLKLG
IYQDVGTLTCAGYPGSFGYYDIDAQTFADWGVDLLKFDGCYYKDIESLVEGYKHMSIALN
KTGRSILYSCEWPLYTRPFQEPNYTEIRQYCNHWRNYVDILDSWRSVKSILAWTASKQDS
LVPAAGPGGWNDPDMLVIGNFGLSWDQQVTQMALWAIMAAPLFMSNDLRHISCRSKALLQ
NKDVIAINQDPLGKQGYLLRKDKNFEVWERPLSNLAWAVAVLNQKEIGGPQNYAFSTSAL
GQGVGCAPACFITQILPVKEELGLYTWVSLLKVQVNPTGTVLLKLQAYQQHEYSSHTTRA
DFVSSNTTNDYHDYNYNNATSDDIISIITVLDPL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcctttgccgctctgaccctggttctgctgggtggacctgggatcactgccctg
gacaatggattagctctgacccccactatgggctggctgccctgggagcgcttcacatgc
aatgtgaactgcatccaggacccagagaactgcattagtgaacaactctttatgcagatg
gctgatctcatggtatcagaaggctggaaggatgcgggctatgagtacgtctgcatcgat
gactgttggttggcctccaaacgaaataaagatggtacactcaaggcagaccccaaacgc
ttcccgagtggaattcggcatttggcaaattatgtacactccagggggctgaagttgggc
atttatcaagatgtaggaactctcacctgcgctggatacccaggaagctttggctactac
gatattgatgcccaaacctttgccgattggggagtggacctgctcaagtttgatggatgt
tactataaagacatagaaagtttggtagagggctacaagcacatgtccatcgccctcaac
aaaactggcagaagtattctatattcctgtgagtggcctctatatacgagacccttccag
gagcccaattacacagaaattcgacagtattgcaaccactggaggaactatgtcgatatc
ttggactcttggagaagcgtgaagagtattctggcctggaccgcgtctaaacaggacagc
cttgttcctgccgctggaccggggggttggaacgatcccgacatgctagtgatcggcaac
tttggactcagctgggatcaacaagtgactcagatggccctgtgggctatcatggcggcc
ccactcttcatgtccaatgacctacgccacatcagctgccgatccaaggctctgctccag
aataaagatgtcattgcaatcaaccaggatcctttgggcaagcagggctacctgctcagg
aaggacaagaacttcgaagtgtgggaacgacccctgtcgaatttagcctgggccgtggct
gtgctaaaccagaaagagatcggggggcctcagaattatgccttttccacttctgctctg
ggccagggagtaggctgtgcccctgcttgctttatcacccagatcctccctgttaaagaa
gagctgggactttatacatgggtatctctgttgaaggttcaggtaaaccccacaggtact
gtcctgttgaagctacaggcttaccagcaacacgaatattccagccataccacccgggct
gactttgtttccagtaataccaccaatgactaccatgactacaattacaacaatgctacc
tctgatgacatcatttccattataactgtcttagatcccttataa

DBGET integrated database retrieval system