KEGG   Monodelphis domestica (opossum): 100021586Help
Entry
100021586         CDS       T01031                                 

Gene name
GLS
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100021586 (GLS)
   00330 Arginine and proline metabolism
    100021586 (GLS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    100021586 (GLS)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    100021586 (GLS)
  Nervous system
   04724 Glutamatergic synapse
    100021586 (GLS)
   04727 GABAergic synapse
    100021586 (GLS)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100021586 (GLS)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     100021586 (GLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 663 aa AA seqDB search
MMRLRGSAMLRELLLLHPPAAGAALRRGQPLTTLCRRSRAGGRAAVTAGELFPWRGGGAR
RLAPPLARGLSNSPSEILQNLGKGSAKPEASQQSQSSTPPKDGPGEANAYGNGEGKELAG
GENRIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMDMLKLTL
QTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELFESAKKQSGGKV
ADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDLGTEYVH
RYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQFLNKMA
GNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCES
ASVMAATLANGGFCPITGERILSPEAVRNTLSLMHSCGMYDFSGXFAFHVGLPAKSGVAG
GILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLDPRREG
GDQRVKSVINLLFAAYTGDVSALRRFALSGMDMEQRDYDSRTALHVAAAEGHVEVVKFLL
EACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPPEDSSDGKENQTVHKNLD
GLL
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggctccgaggctccgcgatgctgcgggagctgctgctgctgcatccgccagcc
gccggggcggctctgagacggggacagcccctcactaccttgtgccggcgctcccgggcc
gggggccgagctgccgttacggccggagagctgttcccatggcggggtggaggtgcccgc
cgtcttgcaccccccctagcccgggggctgtcgaactcgccttcggagatccttcagaac
ctgggcaagggaagcgccaagccagaggcatcgcaacagtcgcagtcatcgacccctcct
aaggacggccccggcgaggccaacgcctatggcaacggcgaagggaaggagctggctggg
ggagaaaataggataaaacagggtcttctacctagtttggaggatttgctgttctatacc
attgcagaaggacaagaaaaaataccagtccataaattcattactgcactgaaatctaca
ggattgcggacttctgatcccaggttgaaagagtgtatggatatgttgaaattaactctt
cagacaacatcagatggtgtcatgctagacaaagatctttttaaaaaatgtgttcaaagc
aacattgtgctacttacacaagcctttaggagaaagtttgtcattccagactttatgtca
tttacctcacacattgatgaattgtttgaaagtgctaaaaagcagtccggaggaaaggtt
gctgattacatccctcaactggccaaatttagcccagatttgtggggagtgtcggtatgt
actgtggatggacagaggcattctattggagataccaaagtacccttttgtcttcagtcc
tgtgtaaagcccttgaaatatgccattgctgtaaatgaccttggaacagaatatgtgcat
cgatatgttggaaaagagcccagtggtttaagattcaacaaactcttcctgaatgaagat
gataagcctcataaccctatggtgaatgctggagcaattgttgttacttctttaataaag
caaggagtaaataatgcagaaaaatttgactatgtgatgcagtttttgaataagatggct
ggtaatgaatatgttggattcagtaatgccacatttcagtccgaacgagaaagtggagat
cggaattttgcaataggttattacttaaaggaaaaaaagtgttttcctgaaggcacagac
atggttggtatattagacttctacttccagctgtgttccattgaagtgacttgtgaatca
gccagtgtgatggctgccacattagctaatggtggtttctgcccaattactggtgaaaga
atactaagccctgaagcagttcgaaatacactaagtttgatgcattcttgtggcatgtat
gacttctcaggtncatttgctttccatgttggtcttcctgcaaaatctggagttgctgga
ggcattcttttagttgttcctaatgttatgggaatgatgtgttggtctcctccattggat
aaaatgggcaacagtgttaagggaattcacttctgtcatgatcttgtttctttgtgtaat
ttccataactatgataatttgaggcactttgcaaaaaaactcgatcctcgaagagaaggt
ggtgatcaaagggtgaagtcagtgataaatctcttgtttgctgcatatactggagatgtg
tcagcccttcgaagatttgctttgtcggggatggatatggagcagcgggactacgattct
cgaactgcattgcatgttgcagctgcagaaggtcacgtggaagtggttaaatttttgttg
gaagcctgcaaagtgaatcctttccccaaggacaggtggaataacacccccatggacgaa
gccctgcactttggacaccacgacgtgtttaaaatccttcaggaataccaagtccagtac
acacctccagaagattccagcgacggcaaagaaaaccaaacagtccataagaatctagat
ggattgttataa

DBGET integrated database retrieval system