KEGG   Monodelphis domestica (opossum): 100021838Help
Entry
100021838         CDS       T01031                                 

Definition
insulin receptor substrate 1-like
Orthology
K16172  
insulin receptor substrate 1
Organism
mdo  Monodelphis domestica (opossum)
Pathway
FoxO signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Neurotrophin signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Aldosterone-regulated sodium reabsorption
MicroRNAs in cancer
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:mdo04068]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mdo04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:mdo04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:mdo04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:mdo04920]
Organismal Systems; Excretory system; Aldosterone-regulated sodium reabsorption [PATH:mdo04960]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:mdo04722]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:mdo05206]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:mdo04930]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:mdo04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 1243 aa AA seqDB search
MASPPEGDGCFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSGA
PKRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSESEQESWYQALLQLHNRAKG
HHLHHSHHEAAAFGVGGGGGGGSCSGSSGLGEGGEDSSYGEMAPGPAFKEVWQVILKPKG
LGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTG
PGEFWMQVDDSVVAQNMHETILEAMRAMSEEFRPRSKSQSSSNCSNPISVPLRRHHLNNP
PPSQVGLTRRSRTESVTATSPASVVGGKPCSFRVRASSDGEGTMSRPASVDGSPVSPSTN
RTHSHRHRGSSRLHPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRS
SASVSGSPSDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEDLSNYICMGGKN
TPNLMAPNGHYNLSRGGNGHRYTPGAGPSPATVGEEAATAADLEKSFRKRTHSAGTSPTI
SHQKTPSQSSVASIEEYTEMMPSYPPCSSAGTGNRMQAYRHSAFVPTHSYPEECLEIHPL
EERGGHHHRGDTPGLHTDDGYMPMSPGVAPVPSSRKSGGDYMPMSPKSVSAPQQIINPGR
RHSQRVDPNGYMMMSPSGSCSPDGAGGSGNGNAATPGNSYGKLWTNGVGGHHHHHHGHPK
LSMESSDGKLPCSSDYINMSPAGDSATSSPSEGYYGPDDPQGKAIYSYYSLPRSFKHTQQ
QQRRGEPEDGGRLHHLRLSASSGRLLYATAAEDSSSSASSDSLGGGGGGQEGVHGHLHHQ
ALHQHLPRKMDLVAQTKSRLTRPTRLSLDGPKASTLPRAREQPQQPLLPPEPKSPGEYVN
IEFVGEQPSYPHGSAISLCSPTVRCPAPRQPAPREEDPGSEEYMNMDLRPPRRPACQEGF
GSKAGRACPLPTGVGGVCRPSRALPNSQDYVTMQVGGPCSGCADASLSYVVMQTSRASEE
SSVPGAASAAPSPAFTAATPSLPQHPGQAELASRPSLLGGPKGPGGISAFTRVNLSPSRN
QSAKVIRADPQGCRRRHSSETFSSTPSAARGSNVAVPFGAAGAGGSGTSGGGSSEDVKRH
SSASFENVWLKPGDVGGPPSRKETPQMSGGAPAGAAAGLENGLNYIDLDLVKDFNHRPQE
CPPLLQPPHQPCGSGGGSGSGCSSEDLSAYASISFQKQPEDLP
NT seq 3732 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtccaccggagggggacggctgcttctcagatgtgcggaaggtgggctacctc
cgcaaacccaagagcatgcacaaacgcttcttcgtcctgcgggcagctagtgaggccggg
ggtccagcccgcctggagtactacgagaacgaaaagaagtggaggcacaaatcgggtgcc
cccaagcgctctatcccgctagagagctgcttcaacatcaacaagcgggctgactccaag
aacaaacacctggtagccctctacacccgggatgagcattttgccattgccgcggacagc
gagtcggagcaggagagctggtaccaggcgctcctgcagctccacaaccgggccaagggg
catcacttgcaccattcccaccacgaggctgcagcttttggagtgggagggggaggagga
ggagggagctgcagcggcagctctggcctgggagaagggggtgaggacagtagctatggt
gaaatggccccaggacccgcattcaaggaggtttggcaagtgatcctgaagcctaagggc
ttggggcagacaaagaacctgattggtatctaccggctctgcttgaccagtaagaccatc
agctttgtgaagctcaactcagaggcagccgcagtggtcctccaattgatgaacattcgc
aggtgtggccactcggaaaacttcttttttattgaggtggggcgctctgccgtgactggg
cctggggagttctggatgcaagtggatgactctgtagttgcccaaaatatgcatgagact
atcctggaagccatgcgggccatgagtgaggagttccggcctcggagcaagagccaatcg
tcctctaactgctccaaccccatcagtgtccctcttcgcaggcatcacctcaataacccc
ccacccagccaagtggggctcactcggaggtcccggactgagagtgtcactgccacatcc
ccagctagtgtggttggtgggaagccctgctctttccgtgtccgggcttctagtgatgga
gaaggcaccatgtcccggccagcttcagtggacgggagccctgtgagtcccagtaccaac
cggacccattcacaccgacatcggggcagctcccggttgcatccccctcttaaccacagc
cgctccatccccatgccctcctcccgatgttccccttcagccacaagtccagtcagcttg
tcatccagcagcaccagtggccatggatcaacttcagactgcctcttccctaggaggtcc
agtgcctctgtgtctggctcccccagtgatgggggcttcatctcttccgatgaatatggc
tccagcccttgtgacttccgaagttctttccggagtgtcacccctgattccttgggtcat
accccaccagctaggggcgaggaagacctgagcaactatatctgcatgggaggcaaaaac
acacctaacttgatggcccccaatggccactataacctctccaggggtggcaatgggcac
cggtatacccccggagctggccccagccctgctacagttggagaggaggcagccactgct
gcagacctggagaaaagtttcagaaagagaactcactcagcaggtacttctcccaccatt
tcccaccagaagaccccctcacaatcctccgttgcctccattgaggagtacacagagatg
atgccttcctacccaccctgttcctcagcgggcaccgggaaccggatgcaagcctaccgg
cactcagcctttgtgcccacccattcctatcccgaggagtgtctggaaatccatccctta
gaggagcggggaggccaccatcaccggggggacactcccgggctacacaccgatgatggc
tacatgcccatgtctcctggggtagccccagtgcccagcagccgaaagagtgggggagat
tacatgcccatgagccccaagagcgtgtctgccccgcagcagatcattaaccctggccgg
aggcattcccaaagggtagatcccaatggctacatgatgatgtcccccagtggcagctgt
tccccggatggcgcagggggctcaggcaatggcaatgcggccacccctgggaacagctat
ggcaagttatggacaaacggggttggtggccaccatcaccatcaccacgggcaccccaag
ctctccatggagagcagtgatgggaagctgccctgcagcagcgactacattaacatgtcc
ccagccggagactcggccaccagcagcccctccgagggctactatggaccagatgacccg
cagggcaaggccatctactcctactactcactgcctcgctccttcaagcacacccagcag
cagcagcgtcgaggggagcccgaagatggcggccggctccaccacctgcgcctctctgcc
agctccggccgccttctctacgccacagcggcggaggactcgtcttcttccgccagcagt
gacagcctgggaggaggtggaggtggccaggaaggggtgcacggccacctccaccatcag
gccctacaccagcacctgccccgaaagatggatctagttgcccagaccaagagccgcctg
actcggcccacaagactctctctggatggccccaaggccagcaccttacccagggctcgg
gagcagccccagcagcctcttcttcctccagagcccaagagcccgggagaatacgtgaat
attgagtttgtaggtgagcagcccagctacccgcatggctcagccatctccctctgctct
cccaccgtcaggtgcccagccccgcgccagccggcccccagagaggaggaccctggctcc
gaggaatatatgaacatggacttgaggcctcccaggaggccggcctgccaggaaggcttt
gggtcgaaggcgggaagagcctgccccctgcccaccggggtaggtggtgtgtgcaggccc
agccgggcactgccaaacagccaggattacgtgaccatgcaggtgggtgggccctgctca
ggctgtgccgatgcttctctcagctatgtggtgatgcagacaagcagggcttccgaggag
tccagcgtcccaggcgctgcctctgccgccccttccccagcttttactgccgccaccccc
tccctcccccagcacccaggccaggcagagctggctagccgcccctccctgctaggaggt
ccaaagggacccggagggattagcgccttcactcgagtgaacctcagccctagccgcaac
cagagtgccaaagtgatccgggctgacccccaaggatgccggaggcggcacagctccgag
actttttcctccacccccagtgctgcccggggcagtaacgttgcagtgccctttggggcg
gctggcgcaggtggctctgggaccagcggcggcggcagcagcgaagatgttaaacgccac
agttctgcctcctttgaaaatgtctggctaaagcctggggatgtagggggcccacccagc
aggaaggagaccccccagatgagtgggggtgcccccgcgggagcagcggccggtttggag
aacggactcaactacatcgacctggatttggtcaaggattttaatcaccggccccaggag
tgcccccctctgctgcagcctcctcatcagccctgtggcagtggtgggggcagtggcagc
ggctgttccagtgaggatctaagcgcctatgctagcatcagctttcagaagcagccagag
gaccttccatag

DBGET integrated database retrieval system