KEGG   Monodelphis domestica (opossum): 100021838Help
Entry
100021838         CDS       T01031                                 

Gene name
IRS1
Definition
insulin receptor substrate 1
Orthology
K16172  
insulin receptor substrate 1
Organism
mdo  Monodelphis domestica (opossum)
Pathway
cGMP-PKG signaling pathway
FoxO signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Neurotrophin signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Aldosterone-regulated sodium reabsorption
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100021838 (IRS1)
   04022 cGMP - PKG signaling pathway
    100021838 (IRS1)
   04151 PI3K-Akt signaling pathway
    100021838 (IRS1)
   04152 AMPK signaling pathway
    100021838 (IRS1)
   04150 mTOR signaling pathway
    100021838 (IRS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100021838 (IRS1)
   04920 Adipocytokine signaling pathway
    100021838 (IRS1)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100021838 (IRS1)
  Nervous system
   04722 Neurotrophin signaling pathway
    100021838 (IRS1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100021838 (IRS1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100021838 (IRS1)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100021838 (IRS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 1243 aa AA seqDB search
MASPPEGDGCFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSGA
PKRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSESEQESWYQALLQLHNRAKG
HHLHHSHHEAAAFGVGGGGGGGSCSGSSGLGEGGEDSSYGEMAPGPAFKEVWQVILKPKG
LGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTG
PGEFWMQVDDSVVAQNMHETILEAMRAMSEEFRPRSKSQSSSNCSNPISVPLRRHHLNNP
PPSQVGLTRRSRTESVTATSPASVVGGKPCSFRVRASSDGEGTMSRPASVDGSPVSPSTN
RTHSHRHRGSSRLHPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRS
SASVSGSPSDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEDLSNYICMGGKN
TPNLMAPNGHYNLSRGGNGHRYTPGAGPSPATVGEEAATAADLEKSFRKRTHSAGTSPTI
SHQKTPSQSSVASIEEYTEMMPSYPPCSSAGTGNRMQAYRHSAFVPTHSYPEECLEIHPL
EERGGHHHRGDTPGLHTDDGYMPMSPGVAPVPSSRKSGGDYMPMSPKSVSAPQQIINPGR
RHSQRVDPNGYMMMSPSGSCSPDGAGGSGNGNAATPGNSYGKLWTNGVGGHHHHHHGHPK
LSMESSDGKLPCSSDYINMSPAGDSATSSPSEGYYGPDDPQGKAIYSYYSLPRSFKHTQQ
QQRRGEPEDGGRLHHLRLSASSGRLLYATAAEDSSSSASSDSLGGGGGGQEGVHGHLHHQ
ALHQHLPRKMDLVAQTKSRLTRPTRLSLDGPKASTLPRAREQPQQPLLPPEPKSPGEYVN
IEFVGEQPSYPHGSAISLCSPTVRCPAPRQPAPREEDPGSEEYMNMDLRPPRRPACQEGF
GSKAGRACPLPTGVGGVCRPSRALPNSQDYVTMQVGGPCSGCADASLSYVVMQTSRASEE
SSVPGAASAAPSPAFTAATPSLPQHPGQAELASRPSLLGGPKGPGGISAFTRVNLSPSRN
QSAKVIRADPQGCRRRHSSETFSSTPSAARGSNVAVPFGAAGAGGSGTSGGGSSEDVKRH
SSASFENVWLKPGDVGGPPSRKETPQMSGGAPAGAAAGLENGLNYIDLDLVKDFNHRPQE
CPPLLQPPHQPCGSGGGSGSGCSSEDLSAYASISFQKQPEDLP
NT seq 3732 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtccaccggagggggacggctgcttctcagatgtgcggaaggtgggctacctc
cgcaaacccaagagcatgcacaaacgcttcttcgtcctgcgggcagctagtgaggccggg
ggtccagcccgcctggagtactacgagaacgaaaagaagtggaggcacaaatcgggtgcc
cccaagcgctctatcccgctagagagctgcttcaacatcaacaagcgggctgactccaag
aacaaacacctggtagccctctacacccgggatgagcattttgccattgccgcggacagc
gagtcggagcaggagagctggtaccaggcgctcctgcagctccacaaccgggccaagggg
catcacttgcaccattcccaccacgaggctgcagcttttggagtgggagggggaggagga
ggagggagctgcagcggcagctctggcctgggagaagggggtgaggacagtagctatggt
gaaatggccccaggacccgcattcaaggaggtttggcaagtgatcctgaagcctaagggc
ttggggcagacaaagaacctgattggtatctaccggctctgcttgaccagtaagaccatc
agctttgtgaagctcaactcagaggcagccgcagtggtcctccaattgatgaacattcgc
aggtgtggccactcggaaaacttcttttttattgaggtggggcgctctgccgtgactggg
cctggggagttctggatgcaagtggatgactctgtagttgcccaaaatatgcatgagact
atcctggaagccatgcgggccatgagtgaggagttccggcctcggagcaagagccaatcg
tcctctaactgctccaaccccatcagtgtccctcttcgcaggcatcacctcaataacccc
ccacccagccaagtggggctcactcggaggtcccggactgagagtgtcactgccacatcc
ccagctagtgtggttggtgggaagccctgctctttccgtgtccgggcttctagtgatgga
gaaggcaccatgtcccggccagcttcagtggacgggagccctgtgagtcccagtaccaac
cggacccattcacaccgacatcggggcagctcccggttgcatccccctcttaaccacagc
cgctccatccccatgccctcctcccgatgttccccttcagccacaagtccagtcagcttg
tcatccagcagcaccagtggccatggatcaacttcagactgcctcttccctaggaggtcc
agtgcctctgtgtctggctcccccagtgatgggggcttcatctcttccgatgaatatggc
tccagcccttgtgacttccgaagttctttccggagtgtcacccctgattccttgggtcat
accccaccagctaggggcgaggaagacctgagcaactatatctgcatgggaggcaaaaac
acacctaacttgatggcccccaatggccactataacctctccaggggtggcaatgggcac
cggtatacccccggagctggccccagccctgctacagttggagaggaggcagccactgct
gcagacctggagaaaagtttcagaaagagaactcactcagcaggtacttctcccaccatt
tcccaccagaagaccccctcacaatcctccgttgcctccattgaggagtacacagagatg
atgccttcctacccaccctgttcctcagcgggcaccgggaaccggatgcaagcctaccgg
cactcagcctttgtgcccacccattcctatcccgaggagtgtctggaaatccatccctta
gaggagcggggaggccaccatcaccggggggacactcccgggctacacaccgatgatggc
tacatgcccatgtctcctggggtagccccagtgcccagcagccgaaagagtgggggagat
tacatgcccatgagccccaagagcgtgtctgccccgcagcagatcattaaccctggccgg
aggcattcccaaagggtagatcccaatggctacatgatgatgtcccccagtggcagctgt
tccccggatggcgcagggggctcaggcaatggcaatgcggccacccctgggaacagctat
ggcaagttatggacaaacggggttggtggccaccatcaccatcaccacgggcaccccaag
ctctccatggagagcagtgatgggaagctgccctgcagcagcgactacattaacatgtcc
ccagccggagactcggccaccagcagcccctccgagggctactatggaccagatgacccg
cagggcaaggccatctactcctactactcactgcctcgctccttcaagcacacccagcag
cagcagcgtcgaggggagcccgaagatggcggccggctccaccacctgcgcctctctgcc
agctccggccgccttctctacgccacagcggcggaggactcgtcttcttccgccagcagt
gacagcctgggaggaggtggaggtggccaggaaggggtgcacggccacctccaccatcag
gccctacaccagcacctgccccgaaagatggatctagttgcccagaccaagagccgcctg
actcggcccacaagactctctctggatggccccaaggccagcaccttacccagggctcgg
gagcagccccagcagcctcttcttcctccagagcccaagagcccgggagaatacgtgaat
attgagtttgtaggtgagcagcccagctacccgcatggctcagccatctccctctgctct
cccaccgtcaggtgcccagccccgcgccagccggcccccagagaggaggaccctggctcc
gaggaatatatgaacatggacttgaggcctcccaggaggccggcctgccaggaaggcttt
gggtcgaaggcgggaagagcctgccccctgcccaccggggtaggtggtgtgtgcaggccc
agccgggcactgccaaacagccaggattacgtgaccatgcaggtgggtgggccctgctca
ggctgtgccgatgcttctctcagctatgtggtgatgcagacaagcagggcttccgaggag
tccagcgtcccaggcgctgcctctgccgccccttccccagcttttactgccgccaccccc
tccctcccccagcacccaggccaggcagagctggctagccgcccctccctgctaggaggt
ccaaagggacccggagggattagcgccttcactcgagtgaacctcagccctagccgcaac
cagagtgccaaagtgatccgggctgacccccaaggatgccggaggcggcacagctccgag
actttttcctccacccccagtgctgcccggggcagtaacgttgcagtgccctttggggcg
gctggcgcaggtggctctgggaccagcggcggcggcagcagcgaagatgttaaacgccac
agttctgcctcctttgaaaatgtctggctaaagcctggggatgtagggggcccacccagc
aggaaggagaccccccagatgagtgggggtgcccccgcgggagcagcggccggtttggag
aacggactcaactacatcgacctggatttggtcaaggattttaatcaccggccccaggag
tgcccccctctgctgcagcctcctcatcagccctgtggcagtggtgggggcagtggcagc
ggctgttccagtgaggatctaagcgcctatgctagcatcagctttcagaagcagccagag
gaccttccatag

DBGET integrated database retrieval system