KEGG   Monodelphis domestica (opossum): 100022041Help
Entry
100022041         CDS       T01031                                 

Gene name
PFKP
Definition
phosphofructokinase, platelet
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
AMPK signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100022041 (PFKP)
   01230 Biosynthesis of amino acids
    100022041 (PFKP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100022041 (PFKP)
   00030 Pentose phosphate pathway
    100022041 (PFKP)
   00051 Fructose and mannose metabolism
    100022041 (PFKP)
   00052 Galactose metabolism
    100022041 (PFKP)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100022041 (PFKP)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100022041 (PFKP)
Protein phosphatases and associated proteins [BR:mdo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100022041 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 785 aa AA seqDB search
MAERHSEQIANRSLIGVGKVIAVLTSGGDAQGMNAAVRAVVRMGIYVGAKMFFVHEGYQG
MVDGGSNIVQVSWESVSSILQRGGTVIGSARCSAFRNREGRLKAAANLLEKGITNLCVIG
GDGSLTGANLFREEWSGLLDELAKNGKISKDDVKNYSHLNIVGLVGSIDNDFCGTDMTIG
TDSALHRIIEVVDAIMTTALSHQRTFVLEVMGRHCGYLALASALACGADWVFIPESPPED
DWEKHMVEKLSENRAHKKRLNIIIVAEGAIDAQNQPITSEKIKNLVVDELGFDTRVTILG
HVQRGGTPSAFDRILASRTGVEAVLALLEAKPETPACVVSLSGNHIVRLPLMECVKMTQA
VQKAMDKKDFKKAVKLRGRSFENNLQTYKLLSQKETTAEIPKSNFNVAVMNVGAPAAGMN
AAIRSAVRVGITEGHKMLVVNNGFEGLSKGEIKEFHWTCVRGWTGQGGSILGTKRTLPAM
YLEQIAEQIRTYKINGLLVVGGFEAYLGLLELSAAREKYKEFCIPMIMVPATVSNNIPGS
DFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLASMGGLSAGADVAYIF
EEKFDIRELQANVRHLTEKMKTNIQRGLVLRNENCNENYTTDFIYQLYSEEGKGVFDCRK
NVLGHMQQGGAPSPFDRNFATKISAKAMQWLTKKLQDNFQDGKVFVNDDDSVCLLGMRTR
TLLFQPVVELKKETDFEHRIPKEQWWLKLRPLMKILAKYKISYQVPSSAKLENIECRTRE
GNEAS
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcgtcatagcgagcagatcgcaaatcggagtctaattggtgttggcaaagtc
atcgcggtccttactagcggcggcgatgcccaaggaatgaatgcagctgttcgagctgtg
gtgcggatgggaatctatgtgggagccaaaatgttttttgtgcatgagggttatcaaggt
atggtagatggaggctctaatattgttcaagtgtcctgggaaagtgtttcaagtattctc
caaaggggaggaacagtcattggcagtgcacgttgttcagcattccgtaaccgggaaggc
cgtttaaaagcagctgcaaacttgcttgaaaaaggaattactaatctgtgtgtgattggt
ggggatggaagcttaactggagctaacctttttcgggaagaatggagtggactattggac
gaattggctaaaaatggtaaaatcagtaaagatgacgtcaagaattattcccacctcaac
atcgtggggttggtgggttctatagacaatgacttctgtgggacggatatgacaattggc
actgactcggctttgcacagaatcattgaagttgtggatgccatcatgaccactgctctg
agtcaccagaggacctttgttctggaggttatgggaagacattgtgggtacctggccctc
gcaagtgccttagcttgtggtgcagattgggtgtttattcctgaaagcccaccagaagac
gactgggaaaagcacatggtagaaaagctatcagagaatcgtgcccataagaagagactg
aacatcataattgtggcagaaggggcaattgatgcccaaaatcaacctattacttcagaa
aagattaagaatcttgtagttgatgagctgggatttgatactcgtgtgactatccttgga
catgtccaaagaggaggaaccccttcagcttttgacaggattttggctagtcgcacaggt
gtggaggcagtattggctcttcttgaggctaaaccggaaaccccagcatgtgttgtgtct
ttgtctggaaaccacatcgtgcgtctgcccctgatggagtgtgtaaaaatgactcaggct
gttcaaaaggcaatggataaaaaggattttaagaaggcagtgaaacttcgaggaaggagc
tttgagaacaacttacaaacctataaactactttctcagaaagaaacaacggcagagatt
ccaaagagcaattttaacgtggctgttatgaatgtgggtgctcctgctgcagggatgaac
gctgccatccgttcagcagtgagagtgggcatcactgagggtcataaaatgctggttgtc
aataatggctttgaaggattgtctaaaggtgagataaaagaattccactggacatgtgtt
agaggctggactggtcaaggaggatcaattcttggcacaaaacgtactctccctgcaatg
tatttggagcagattgctgaacagatacgtacttataaaatcaacggtcttttggttgtc
ggtggatttgaggcctacctgggattgctggaactgtcagctgcccgtgagaaatataag
gaattctgtattccaatgattatggttcctgctactgtatccaacaatatacccggttcc
gatttcagcattggtgcagacactgccctgaacactatcaccgatacctgtgatcgaatc
aagcagtccgcgagtgggaccaagaggcgagtcttcatcatcgagacgatgggcggctac
tgtggctacctggccagcatggggggcctctctgctggggccgacgtagcatatattttt
gaagaaaaatttgacatccgagaactacaggctaacgtgaggcatttgacagagaaaatg
aagaccaacatacaacgaggcctggtgctcagaaatgagaactgtaatgaaaattatacc
actgatttcatttaccaactctattctgaggaaggaaaaggtgtatttgattgcagaaag
aatgtcttgggtcacatgcaacagggtggagcgccttctccttttgacagaaactttgca
acaaaaatttctgccaaagctatgcagtggcttactaagaaactacaggacaactttcaa
gacggaaaagtatttgtcaacgatgatgattcagtttgtctgctaggaatgcgcacacgg
actctacttttccaacctgtggttgaactaaagaaggaaacagattttgagcacagaatt
cccaaagaacaatggtggttgaaactacgacctttgatgaaaattttggccaaatacaaa
atcagctatcaagttccctcttcagctaagctggaaaatatagaatgcagaacgagagaa
ggaaatgaagcctcataa

DBGET integrated database retrieval system