KEGG   Monodelphis domestica (opossum): 100022042Help
Entry
100022042         CDS       T01031                                 

Definition
mRNA export factor-like
Orthology
K14298  
mRNA export factor
Organism
mdo  Monodelphis domestica (opossum)
Pathway
RNA transport
Influenza A
Class
Genetic Information Processing; Translation; RNA transport [PATH:mdo03013]
Human Diseases; Infectious diseases; Influenza A [PATH:mdo05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 368 aa AA seqDB search
MSLFGTTSGFGTGGTSMFGSTATDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAG
SWANDVRCWEVQDNGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQA
IQIAQHDAPVKTVHWIKAPNYSCVMTGSWDKTLKFWDTRSPSPMMTLQLPERCYCADVVY
PMAAVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagcctatttggaacaacctcgggttttggaactggtgggacaagcatgtttggtagt
acagcaacagataatcacaatcctatgaaggatattgaagttacatcttctcctgatgac
agtattggatgtctttcttttagcccacctacattaccagggaactttcttattgcagga
tcctgggccaatgacgttcgatgttgggaagttcaagataatggacagactattccaaaa
gctcagcagatgcatacagggcccgtgcttgatgtctgttggagtgatgatgggagtaaa
gtctttacagcatcctgtgataaaactgctaaaatgtgggacctcaacagtaaccaagct
atacagattgcacagcatgatgctcctgtgaaaactgtgcattggatcaaagcaccaaac
tatagctgcgtgatgacaggaagctgggataaaactttaaagttttgggacactcggtca
ccaagtcctatgatgacattgcaactgcctgaaagatgttactgtgctgatgtggtctac
cccatggcagctgtagctactgctgagagaggattgatagtttatcagttagagaatcag
ccttctgaattcagaagaatagaatctcctcttaaacatcagcatcgctgtgttgccatt
tttaaagacaaacagaataagcctactggttttgctctgggaagtattgaaggaagagtt
gctattcattatattaatccaccaaatcctgccaaagataactttacctttaagtgtcat
cgttctaatggaactaatacttcagctcctcaagatatctatgctgtgaatgggatagca
tttcatcctgttcatggaactcttgcaactgtgggatctgatggtagattcagtttttgg
gacaaagatgcaaggacaaaactaaaaacttcagaacaattagatcagccaatttcagct
tgttgtttcaatcacaatggaaacatatttgcgtatgcttctagctatgactggtcaaag
ggacatgaattttataatccccaaaagaaaaattacatttttctacgtaatgcagcagaa
gagttaaagcccagaaataagaagtaa

DBGET integrated database retrieval system