KEGG   Monodelphis domestica (opossum): 100022104Help
Entry
100022104         CDS       T01031                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:mdo00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:mdo00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:mdo04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 661 aa AA seqDB search
MEEAPISGTEVRREEVSPPSEMPPPEAPQGGPVESLQQEGMAPRTPRPPSQGSVTFKDIA
VDFTQEEDGRRRFRNRHVTALVSHDLHPLCSRMRSPMLDLAKLGSLWQLAHSPSRELESS
AILLSALPRWDPRSAGKRDLAKVNNVATSILGLLLLQLISSTSSARPCVPQSFGYSSVVC
VCNATYCDSIDPVTLPASSTFSRYESTQSGRRFELSIGNIQSNWTGKGLLLSLHPEQQFQ
KIKGFGGAMTDAAALNILALSPSAQDLLLKSYFSPEGIEYNIIRVPMGSCDFSVRVYTYA
DQPDDFQLNNFTLPEEDTKFKIPLIHRALALSQRPTSLFASPWTSPTWLKTNGAVNGRGS
LKGQPGDKYHQTWANYFIKFLDAYAEHKVKFWAVTAENEPSAGLISGYPFQCLGFTPELQ
RDFIARDLGPTLAQSAHRDVKLLILDDQRILLPHWAQVVLKDPNAAQYVSGIAIHWYLDF
LAPANATLGETHRLFPDMMLFASEACVGSKFWEQSVRLGSWSRGTKYSHSIITDLNHHVA
GWTDWNLALNLEGGPNWVRNFVDSPIIVDISKDKFYKQPMFYHLGHFSKFIPEGSQRIGL
EANKNHNLETVALLRPDGAMVLVVLNSSSQDQPFTIADPTVGFMQTLAPAYSIQTYLWQH
Q
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagccccaatctcgggcactgaggtgcgcagagaggaagtctcccccccctcg
gagatgccacctcctgaagcaccccagggtggccccgtagagagcctacagcaagaagga
atggcccccaggaccccaaggcccccctcccaggggtcagtaacatttaaggatattgct
gtggactttacccaggaggaagatggccggaggcgcttccgcaaccgtcacgtgacggca
ttggtgtcacatgacctccaccctctgtgttcaagaatgcggagtcctatgttagactta
gcgaagctgggatctctgtggcagctggcgcactctccatcccgggagctggaaagctcc
gccatcctcctgagcgcccttccgagatgggacccccgaagcgctggaaagagagatttg
gccaaagtaaacaacgttgccacaagtatcttgggactgctgttgcttcagctgatttcc
tccacatcaagtgcccggccttgtgttccccaaagctttggctatagctctgttgtgtgt
gtctgcaatgctacctactgtgattcgattgatccggtaacacttcctgcttcaagtacc
tttagccgatatgagagtactcaaagtggccggaggtttgagttgagcattgggaacatc
cagagcaactggacaggcaaaggattgctgctatccctgcacccagagcaacagttccag
aagataaaaggctttggaggtgcaatgactgatgctgctgccctcaacattctagctctc
tcaccttctgcccaggacttacttcttaaatcttacttttctccagaaggtattgaatat
aacatcattcgagttcccatgggcagctgtgacttctctgtccgtgtctatacctatgct
gatcaacctgacgacttccagttgaacaatttcaccctcccagaagaggacaccaagttc
aagattccccttattcacagggctttggccctgtcccaacgccctacatcgctctttgcc
agcccctggacatcacctacttggcttaagaccaatggggcagtaaatgggagagggtca
ctcaaaggacaaccaggagacaagtaccaccagacctgggccaactactttatcaagttt
ctagatgcttatgcagaacataaagtaaaattttgggcagtgacagcggagaatgaacca
tcagcaggattgataagtgggtatcccttccaatgcttgggcttcactccagaacttcaa
cgagatttcattgcccgggacctaggccctactcttgctcaaagtgctcatcgtgatgtc
aaactactaatactggatgaccaacgcattttactgccccattgggcacaggtggttctg
aaggacccgaatgcagctcagtatgtctccgggatagctatacactggtacctggatttc
ctggccccagctaatgctacactgggggaaacacaccggttgttccctgatatgatgctc
tttgcttctgaggcctgtgtgggttccaagttttgggaacagagtgtacggctaggttcc
tggagccgagggacaaaatacagtcatagcatcatcactgatcttaaccaccatgtggca
ggctggacagactggaaccttgccctaaatcttgaagggggtcccaactgggtacgcaac
tttgttgatagccccataattgtagatataagcaaggacaagttttacaagcaaccgatg
ttctaccatctcggacacttcagcaagttcattcctgagggttcccagaggataggactg
gaggccaataagaaccacaacttggagacagtggccttactgcgccctgatggtgccatg
gtgttagtcgtgctcaatagctcttcccaggaccaaccttttacaattgctgatcctact
gtgggcttcatgcaaaccttggcacctgcatactccattcagacatacctctggcagcac
cagtaa

DBGET integrated database retrieval system