KEGG   Monodelphis domestica (opossum): 100022229Help
Entry
100022229         CDS       T01031                                 

Gene name
NUP205
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
mdo  Monodelphis domestica (opossum)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100022229 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 2016 aa AA seqDB search
MAALLAVNSAASLWGPYKDIWQTVGNAIWRRQPEAVHLVDLILKKHKPDFISLFKNPAKN
VQQHEKVQKASTEGVAIQGQQGTRLLPEQLIREAFILSDLFDIGELAAVELLLAGEHQQP
HFPGLTRGLVAVLLYWDGKRCIANSLKALIQSRRGKTWTLELSPELVSMTTRFTDELMEQ
GLTHKILTLLSQIDVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQSLAESLFSWTCQSP
LSKDDTLLLIGHLERVTVEASGSLDSVNLALVMALLYCFDISFIEQGAEDREDIIQQLPL
LTEKQYISSIHSRLQDSQPWKLPGLQATIRLAWALALRGISQLSDVPALAEFTEADEAMA
ELAIADNIFLFLTESVVGSENFYQEEFYIRRIHNLITDFLALMPMKVKQLRNRADEDARM
IHMSLHMGNDLPISLRRDLEHLMLLIAELYKKNPFNLELALEYWCPSEPLQSSTIMGSYL
GVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGLASGPQCAHYCFSLLKVNGSS
HAENIQGAGGSPVSWEHFFHSLMLYHEHLRKDLPSADSVQYRHLPLRGITQKEQDGLIAF
LQLTTTIISWSENARLALCEHPQWTPVVVILGLLQCSIPPILKAELLKTLTAFGKSPEIA
ASLWQSLEYTQILQTIRIPSQRQAIGIEVELNEIESRCEEYPLTRAFCQLISTLVESSFP
SNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQL
EDFVDQFVELRGEEIIAYKPPGFSLMYHLLNESPMLELSLSLLEEGVKQLDTYASFPGKK
HLEKAVQHCLALLNLTLQKENLFMDLLRESQLALIVTPLEQLLQGINPRTKKADNVVNIA
RYLYHGNSNPELAFESAKILCCISCNSNIQIKLVGDFTHDQNISQKLMAGFVECLDSEDA
EEFINPEEELEPDKKLAQIRHETRIHILNLLITSLERNPPNLALYLLGFELKKSVSTTNL
QDPGVLGCPRTCLHAILNILEKGTEGRTGPVAVRESPQLAELCYQVIYQLCACSDTSGPT
MRYLRTSQDFLFSQLQHLPFSNREYEISMLNQMSWLMKTASIELRVTSLNRQRSHTQRLL
HLLLDDMPVKPYSDGEGGIEDENRSVSGFLHFDTATKVRRKILSILDSIDFSQEIPEPLQ
LDFFDRAQIEQVIANCEHKNLRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEIS
TILQYVVGRNKLLQCLHAKRHALESWRQLVEIILTACPQDLIQAEDRQLIIRDLLQDIHD
KILDDDAAQELMPVVAGAVFTLTAHLSQSVRTEQKQPQPPPLPATGTGESQYVLMLDSSF
NSTSSLESMIVGFASIGDSSLHIILKKLLDFILKTGGGFQRVRTHLYGSLLYYLQIAQRP
DEPDTLEAAKKTMWERLTAPEDAFSKLQRENIAIIESYGAALMEVVCRDACDGHEIGRML
ALALLDRIVSVDKQQQWLLYLSNSGYLKVLVDSLVEDDLTLQTLLTPQPPLLKALYTYES
KMAFLTRVAKIQQGALELLKSGVIVRLAQCQVYDMRPEIDHQGLFGMRDPPVFIPAPVDR
YRQILLPALQLCQVILTSSMAQHLQAAGQVLQFLISHSDTIQAILRCQDVSAGSLQELAL
LTGIISKAALPGVLSELDVDVTEGSLMELQGHIGRFQRQCLGLLSRFGGSDRLRQFKFQD
GVEGDRVNKKDEIELAMQQICANVMEYCQSLMLQSSPTFQHAVCLFTPSLSETINRDGPR
QDTQAPVVPYWRLPGLGIIVYLLKQSANDFFTYYDSHRQNVNKLQNVEQLPPDEIKELCQ
SVMPAGVDKISTSQKYILARRRLVKLINNRAILLSLCSYIIETCLFIFWRHLEYYLLRCT
PTDCQDSLLASTASFKNRRLQDTFTSETNLDFRSGLTRVSQHDIEQLQIEAINAFGESLQ
KKLLDIEGLYSKVRSRYCFIQALVRRIRGLLRQPRG
NT seq 6051 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgttgttggcggtaaattcggctgcgagcctctggggtccttacaaagatatt
tggcaaacagtgggaaatgccatttggagaagacaacctgaagctgtccaccttgttgac
cttattttaaagaaacacaaacctgacttcatctcattattcaagaatccagccaaaaat
gttcagcaacatgagaaggttcagaaggcaagtacagaaggtgttgctatacagggtcag
caaggaacccgacttcttcctgagcagctcattagagaagccttcatcctgagtgacctc
tttgacattggtgaactagctgctgttgaacttcttttggctggagaacaccaacagcct
cattttcctggccttacaagaggactagtagctgttcttttgtactgggatggaaagcga
tgcattgcaaattccctcaaggccctgatacagtcacggagaggcaagacatggacacta
gaactcagtcccgagcttgtgtccatgacaacacgctttacagatgaactaatggaacag
ggattgactcataaaatcctaactctgttgtcacaaattgatgtgaacaatgagtttgag
aaactacagcgggagagaggcttgggcagtgaaaaacatcgcaaagaggtttcagatctc
atcaaggaatgccgccagtctttggcagaaagcctgttttcctggacctgccagtcacct
ttaagcaaagatgacactctgctccttattggccatctagaaagagtcacagttgaagct
tctggctcattggatagtgtgaacttggctcttgtcatggctctcctttactgctttgat
atcagttttatagaacagggtgcagaggaccgagaagatataattcaacagctaccactg
ttaacagagaaacaatatatctcatcaattcactcacgtcttcaggactcacaaccttgg
aaactacctggtctgcaagccactattagacttgcttgggcattggctttacggggtata
tcccaactatctgatgtaccagctcttgctgaatttacagaagcagatgaagcaatggca
gaacttgcaattgcagacaatatcttccttttcctaactgagtctgtagtggggtcagaa
aacttctaccaggaagaattttatatccgcagaattcataacctcatcacagatttcctt
gcacttatgccaatgaaggtgaaacagttgcgaaatagagcagatgaagatgctcgaatg
attcacatgagcttgcatatgggtaatgaccttcctatttcacttcggagagatctggaa
caccttatgcttttgattgctgaactgtataaaaaaaacccttttaatttggagcttgca
ttggaatattggtgtccttcagaacctcttcaaagttcaactatcatgggatcttaccta
ggggtagcgcatcagagaccccctcaacgccaggttgtcttgtcaaagtttgttaggcaa
atgggagacctacttcctcctactatttatattccatatctgaaaatgctccagggattg
gccagcggaccacagtgtgctcattactgtttcagtttgttgaaagtcaatggcagtagt
catgctgaaaacattcaaggagcaggtggcagccctgtttcctgggaacatttctttcac
tctttgatgctctatcatgaacacttaaggaaagatctgccaagtgcagatagtgtccag
taccgtcacctgcctttacgaggcattacccagaaggagcaggatggattgattgctttt
ttgcagctcacaactacaatcatttcatggagtgagaatgctcgtttggctctttgtgag
catcctcagtggactcctgtggttgtcatcctgggactcctgcagtgtagtatccctcct
attttaaaagctgagctactgaagacacttacagcctttggaaaatctcctgaaattgct
gcttccctttggcagtctttggaatatacacagatattgcagactataaggatcccaagc
cagagacaagcaattggcattgaggttgaattaaatgaaatagaatccagatgtgaagaa
tatccactgacaagggccttttgtcagcttattagcacactagtagaaagttcatttcca
tctaacttgggtgctggactgcgtccaccaggctttgatccatacttgcagttccttaga
gattctgtgtttctccgatttcgcactagagcttatcgcagagctgctgaaaagtgggaa
gttgctgaggtggtgctggaggtgttttataagctgctcagagattatgaacctcagctg
gaagattttgtggaccagtttgttgaattgcgaggagaagaaatcatagcctataagcct
ccaggatttagtttgatgtatcatcttctgaatgagtcaccaatgttggagctctctctt
agtttgttggaagaaggcgttaagcaacttgatacctatgcatcttttcctggaaagaaa
catttggagaaagcagtgcagcattgccttgctcttctcaacttgacactacagaaggaa
aatctctttatggatctcctaagagaaagtcagctggctctaatagtcactccattagaa
cagttattacaaggcatcaatccccgaactaagaaggcagataatgtggttaacatcgct
aggtacctctatcatggcaatagcaatcctgaactggcttttgaaagtgccaagatcctc
tgctgtatctcttgtaattctaacattcagataaaattagtaggagatttcacacatgat
cagaatataagccagaagttgatggctggatttgtggaatgtttggatagtgaagatgct
gaggaattcattaatccagaagaggagttagaacctgataaaaaactagcacaaatccgt
catgaaacaagaatccacatcttgaatcttctcatcacttctctggaacgcaacccaccc
aaccttgccttatatcttctgggctttgaattgaagaaatctgttagtactacaaacctc
caggatccaggagtcttaggttgcccccggacttgtcttcatgccatattgaatattttg
gagaagggaactgaagggagaacaggccctgtggcagtaagggaatcacctcaactcgca
gaactctgctaccaggttatttatcagctgtgtgcatgctcagatacatctggtccaact
atgagatacttgagaaccagccaagattttttattttctcagttgcagcatctacctttt
tctaatagagagtatgaaatatccatgctgaaccaaatgtcatggcttatgaagactgcc
tcaatagaactaagagtaacttctcttaatcgccagcgctctcacactcagagactactg
catttgttgctagatgacatgccagtcaaaccctactcagatggtgaaggaggaatagaa
gatgaaaataggtctgtcagtggttttcttcactttgatactgccaccaaagtacgtcga
aaaatattaagtattttggattcaattgactttagccaggagattcctgagcctttgcag
ttggatttctttgatcgtgctcagattgagcaagtcattgccaactgtgaacataagaat
ttgagggggcagacagtttgcaatgtcaagcttctgcacagggttcttgtggcagaagta
aatgctcttcagggtatggcagctataggccagagacctttgcttatggaggaaatcagc
actattctacagtatgttgtgggaagaaacaaattattacagtgccttcatgcaaaacgg
catgcactagaatcatggagacagttggtagaaattatactgactgcttgtcctcaggac
ctcattcaagcagaggacagacaactgattattcgtgacctcttacaagacatacatgat
aagatcctggatgatgatgcagcccaagaactaatgccagttgtggcaggggctgtgttt
accctgacagctcacttgagccagtctgtgcgaacagagcagaagcagccccagccacca
cccctccctgctacagggactggagaatcccaatatgttctgatgcttgatagttctttt
aactcaacatcttcactagagagcatgattgtggggtttgcttctattggagattcctca
cttcacatcatattgaagaaacttttagacttcattttgaaaacaggtggtgggttccaa
cgagtgaggacacacttgtatggttctttgctttattatttacagatcgctcagagacca
gatgaaccagatactttagaagcagctaagaagaccatgtgggaacggctgacagcacct
gaagatgctttcagtaaattgcagcgagaaaacatagctatcattgagagttatggagca
gcccttatggaagtagtgtgtcgagatgcctgtgatggccatgagattggaagaatgttg
gccttggcattgcttgaccgaattgtttctgtagataaacaacagcagtggctcttgtat
ctctccaacagtggttacttgaaggtgcttgtggacagtctagtggaagatgacctcact
ctgcagaccttgcttactccccagcctccccttttgaaagctctctatacttatgaatcc
aaaatggcattcttgacaagagtggccaaaatacaacaaggagcattagagctgctgaaa
tctggggtgattgtgagactggcacagtgccaagtctatgacatgcgtccagaaatagac
catcagggactgtttggcatgagagatcctcctgtattcattcctgctccagtggatcga
tatcgccagattcttctccctgccctccagttgtgtcaggtcattctcacatccagtatg
gctcagcatctgcaggcagcaggacaggtgttgcagtttctcatctcccattctgacacc
atacaagcaatattacgctgtcaggatgtcagtgcaggctccctgcaagagctagctctt
ctcacaggaatcatcagcaaagctgcattgcctggggtgctaagtgaactagatgttgat
gtcacggaagggtcgttgatggagctacagggacacatagggcgattccagcgccaatgc
ttaggactattaagtcgctttggtggttcagacagacttcggcaatttaagtttcaagat
ggtgtggaaggagatagagtgaacaagaaagatgagattgaattggctatgcaacagatt
tgtgctaatgtcatggaatattgccagtcactcatgttacagagttctccaacattccag
catgcagtatgtctcttcactcctagcctttctgaaactattaacagagatggaccacga
caagatactcaagctccagtggttccatattggcgtctacctggtttgggcattattgtc
tacttgctgaaacaaagtgctaatgatttcttcacttattatgacagtcatcgacagaat
gtcaacaagctacagaatgtagaacagctccccccagatgagataaaagagttgtgccag
tcagtgatgccagctggggtcgataaaatctccacttcccagaagtacatcttggcaaga
cggcgtttggtgaaattgatcaacaatagagctatattgctgtctctttgttcttacatc
atagagacctgcctatttattttttggcgccacctagaatactatctgttacgatgtact
cccactgattgccaagattctctactggcttctacagcttcatttaaaaataggaggcta
caagatacttttacttcagaaacaaacttggatttcagaagtgggttgactcgagtgagc
cagcatgatatagagcagcttcaaattgaagccatcaatgccttcggtgaatcactgcaa
aagaagcttctggatattgaaggattatattccaaagttcgatcccgctattgttttata
caagcacttgtcagacgtatccgtggcttattaaggcaaccaaggggctaa

DBGET integrated database retrieval system