KEGG   Monodelphis domestica (opossum): 100022229Help
Entry
100022229         CDS       T01031                                 

Gene name
NUP205
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
mdo  Monodelphis domestica (opossum)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100022229 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 2016 aa AA seqDB search
MAALLAVNSAASLWGPYKDIWQTVGNAIWRRQPEAVHLVDLILKKHKPDFISLFKNPAKN
VQQHEKVQKASTEGVAIQGQQGTRLLPEQLIREAFILSDLFDIGELAAVELLLAGEHQQP
HFPGLTRGLVAVLLYWDGKRCIANSLKALIQSRRGKTWTLELSPELVSMTTRFTDELMEQ
GLTHKILTLLSQIDVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQSLAESLFSWTCQSP
LSKDDTLLLIGHLERVTVEASGSLDSVNLALVMALLYCFDISFIEQGAEDREDIIQQLPL
LTEKQYISSIHSRLQDSQPWKLPGLQATIRLAWALALRGISQLSDVPALAEFTEADEAMA
ELAIADNIFLFLTESVVGSENFYQEEFYIRRIHNLITDFLALMPMKVKQLRNRADEDARM
IHMSLHMGNDLPISLRRDLEHLMLLIAELYKKNPFNLELALEYWCPSEPLQSSTIMGSYL
GVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGLASGPQCAHYCFSLLKVNGSS
HAENIQGAGGSPVSWEHFFHSLMLYHEHLRKDLPSADSVQYRHLPLRGITQKEQDGLIAF
LQLTTTIISWSENARLALCEHPQWTPVVVILGLLQCSIPPILKAELLKTLTAFGKSPEIA
ASLWQSLEYTQILQTIRIPSQRQAIGIEVELNEIESRCEEYPLTRAFCQLISTLVESSFP
SNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQL
EDFVDQFVELRGEEIIAYKPPGFSLMYHLLNESPMLELSLSLLEEGVKQLDTYASFPGKK
HLEKAVQHCLALLNLTLQKENLFMDLLRESQLALIVTPLEQLLQGINPRTKKADNVVNIA
RYLYHGNSNPELAFESAKILCCISCNSNIQIKLVGDFTHDQNISQKLMAGFVECLDSEDA
EEFINPEEELEPDKKLAQIRHETRIHILNLLITSLERNPPNLALYLLGFELKKSVSTTNL
QDPGVLGCPRTCLHAILNILEKGTEGRTGPVAVRESPQLAELCYQVIYQLCACSDTSGPT
MRYLRTSQDFLFSQLQHLPFSNREYEISMLNQMSWLMKTASIELRVTSLNRQRSHTQRLL
HLLLDDMPVKPYSDGEGGIEDENRSVSGFLHFDTATKVRRKILSILDSIDFSQEIPEPLQ
LDFFDRAQIEQVIANCEHKNLRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEIS
TILQYVVGRNKLLQCLHAKRHALESWRQLVEIILTACPQDLIQAEDRQLIIRDLLQDIHD
KILDDDAAQELMPVVAGAVFTLTAHLSQSVRTEQKQPQPPPLPATGTGESQYVLMLDSSF
NSTSSLESMIVGFASIGDSSLHIILKKLLDFILKTGGGFQRVRTHLYGSLLYYLQIAQRP
DEPDTLEAAKKTMWERLTAPEDAFSKLQRENIAIIESYGAALMEVVCRDACDGHEIGRML
ALALLDRIVSVDKQQQWLLYLSNSGYLKVLVDSLVEDDLTLQTLLTPQPPLLKALYTYES
KMAFLTRVAKIQQGALELLKSGVIVRLAQCQVYDMRPEIDHQGLFGMRDPPVFIPAPVDR
YRQILLPALQLCQVILTSSMAQHLQAAGQVLQFLISHSDTIQAILRCQDVSAGSLQELAL
LTGIISKAALPGVLSELDVDVTEGSLMELQGHIGRFQRQCLGLLSRFGGSDRLRQFKFQD
GVEGDRVNKKDEIELAMQQICANVMEYCQSLMLQSSPTFQHAVCLFTPSLSETINRDGPR
QDTQAPVVPYWRLPGLGIIVYLLKQSANDFFTYYDSHRQNVNKLQNVEQLPPDEIKELCQ
SVMPAGVDKISTSQKYILARRRLVKLINNRAILLSLCSYIIETCLFIFWRHLEYYLLRCT
PTDCQDSLLASTASFKNRRLQDTFTSETNLDFRSGLTRVSQHDIEQLQIEAINAFGESLQ
KKLLDIEGLYSKVRSRYCFIQALVRRIRGLLRQPRG
NT seq 6051 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgttgttggcggtaaattcggctgcgagcctctggggtccttacaaagatatt
tggcaaacagtgggaaatgccatttggagaagacaacctgaagctgtccaccttgttgac
cttattttaaagaaacacaaacctgacttcatctcattattcaagaatccagccaaaaat
gttcagcaacatgagaaggttcagaaggcaagtacagaaggtgttgctatacagggtcag
caaggaacccgacttcttcctgagcagctcattagagaagccttcatcctgagtgacctc
tttgacattggtgaactagctgctgttgaacttcttttggctggagaacaccaacagcct
cattttcctggccttacaagaggactagtagctgttcttttgtactgggatggaaagcga
tgcattgcaaattccctcaaggccctgatacagtcacggagaggcaagacatggacacta
gaactcagtcccgagcttgtgtccatgacaacacgctttacagatgaactaatggaacag
ggattgactcataaaatcctaactctgttgtcacaaattgatgtgaacaatgagtttgag
aaactacagcgggagagaggcttgggcagtgaaaaacatcgcaaagaggtttcagatctc
atcaaggaatgccgccagtctttggcagaaagcctgttttcctggacctgccagtcacct
ttaagcaaagatgacactctgctccttattggccatctagaaagagtcacagttgaagct
tctggctcattggatagtgtgaacttggctcttgtcatggctctcctttactgctttgat
atcagttttatagaacagggtgcagaggaccgagaagatataattcaacagctaccactg
ttaacagagaaacaatatatctcatcaattcactcacgtcttcaggactcacaaccttgg
aaactacctggtctgcaagccactattagacttgcttgggcattggctttacggggtata
tcccaactatctgatgtaccagctcttgctgaatttacagaagcagatgaagcaatggca
gaacttgcaattgcagacaatatcttccttttcctaactgagtctgtagtggggtcagaa
aacttctaccaggaagaattttatatccgcagaattcataacctcatcacagatttcctt
gcacttatgccaatgaaggtgaaacagttgcgaaatagagcagatgaagatgctcgaatg
attcacatgagcttgcatatgggtaatgaccttcctatttcacttcggagagatctggaa
caccttatgcttttgattgctgaactgtataaaaaaaacccttttaatttggagcttgca
ttggaatattggtgtccttcagaacctcttcaaagttcaactatcatgggatcttaccta
ggggtagcgcatcagagaccccctcaacgccaggttgtcttgtcaaagtttgttaggcaa
atgggagacctacttcctcctactatttatattccatatctgaaaatgctccagggattg
gccagcggaccacagtgtgctcattactgtttcagtttgttgaaagtcaatggcagtagt
catgctgaaaacattcaaggagcaggtggcagccctgtttcctgggaacatttctttcac
tctttgatgctctatcatgaacacttaaggaaagatctgccaagtgcagatagtgtccag
taccgtcacctgcctttacgaggcattacccagaaggagcaggatggattgattgctttt
ttgcagctcacaactacaatcatttcatggagtgagaatgctcgtttggctctttgtgag
catcctcagtggactcctgtggttgtcatcctgggactcctgcagtgtagtatccctcct
attttaaaagctgagctactgaagacacttacagcctttggaaaatctcctgaaattgct
gcttccctttggcagtctttggaatatacacagatattgcagactataaggatcccaagc
cagagacaagcaattggcattgaggttgaattaaatgaaatagaatccagatgtgaagaa
tatccactgacaagggccttttgtcagcttattagcacactagtagaaagttcatttcca
tctaacttgggtgctggactgcgtccaccaggctttgatccatacttgcagttccttaga
gattctgtgtttctccgatttcgcactagagcttatcgcagagctgctgaaaagtgggaa
gttgctgaggtggtgctggaggtgttttataagctgctcagagattatgaacctcagctg
gaagattttgtggaccagtttgttgaattgcgaggagaagaaatcatagcctataagcct
ccaggatttagtttgatgtatcatcttctgaatgagtcaccaatgttggagctctctctt
agtttgttggaagaaggcgttaagcaacttgatacctatgcatcttttcctggaaagaaa
catttggagaaagcagtgcagcattgccttgctcttctcaacttgacactacagaaggaa
aatctctttatggatctcctaagagaaagtcagctggctctaatagtcactccattagaa
cagttattacaaggcatcaatccccgaactaagaaggcagataatgtggttaacatcgct
aggtacctctatcatggcaatagcaatcctgaactggcttttgaaagtgccaagatcctc
tgctgtatctcttgtaattctaacattcagataaaattagtaggagatttcacacatgat
cagaatataagccagaagttgatggctggatttgtggaatgtttggatagtgaagatgct
gaggaattcattaatccagaagaggagttagaacctgataaaaaactagcacaaatccgt
catgaaacaagaatccacatcttgaatcttctcatcacttctctggaacgcaacccaccc
aaccttgccttatatcttctgggctttgaattgaagaaatctgttagtactacaaacctc
caggatccaggagtcttaggttgcccccggacttgtcttcatgccatattgaatattttg
gagaagggaactgaagggagaacaggccctgtggcagtaagggaatcacctcaactcgca
gaactctgctaccaggttatttatcagctgtgtgcatgctcagatacatctggtccaact
atgagatacttgagaaccagccaagattttttattttctcagttgcagcatctacctttt
tctaatagagagtatgaaatatccatgctgaaccaaatgtcatggcttatgaagactgcc
tcaatagaactaagagtaacttctcttaatcgccagcgctctcacactcagagactactg
catttgttgctagatgacatgccagtcaaaccctactcagatggtgaaggaggaatagaa
gatgaaaataggtctgtcagtggttttcttcactttgatactgccaccaaagtacgtcga
aaaatattaagtattttggattcaattgactttagccaggagattcctgagcctttgcag
ttggatttctttgatcgtgctcagattgagcaagtcattgccaactgtgaacataagaat
ttgagggggcagacagtttgcaatgtcaagcttctgcacagggttcttgtggcagaagta
aatgctcttcagggtatggcagctataggccagagacctttgcttatggaggaaatcagc
actattctacagtatgttgtgggaagaaacaaattattacagtgccttcatgcaaaacgg
catgcactagaatcatggagacagttggtagaaattatactgactgcttgtcctcaggac
ctcattcaagcagaggacagacaactgattattcgtgacctcttacaagacatacatgat
aagatcctggatgatgatgcagcccaagaactaatgccagttgtggcaggggctgtgttt
accctgacagctcacttgagccagtctgtgcgaacagagcagaagcagccccagccacca
cccctccctgctacagggactggagaatcccaatatgttctgatgcttgatagttctttt
aactcaacatcttcactagagagcatgattgtggggtttgcttctattggagattcctca
cttcacatcatattgaagaaacttttagacttcattttgaaaacaggtggtgggttccaa
cgagtgaggacacacttgtatggttctttgctttattatttacagatcgctcagagacca
gatgaaccagatactttagaagcagctaagaagaccatgtgggaacggctgacagcacct
gaagatgctttcagtaaattgcagcgagaaaacatagctatcattgagagttatggagca
gcccttatggaagtagtgtgtcgagatgcctgtgatggccatgagattggaagaatgttg
gccttggcattgcttgaccgaattgtttctgtagataaacaacagcagtggctcttgtat
ctctccaacagtggttacttgaaggtgcttgtggacagtctagtggaagatgacctcact
ctgcagaccttgcttactccccagcctccccttttgaaagctctctatacttatgaatcc
aaaatggcattcttgacaagagtggccaaaatacaacaaggagcattagagctgctgaaa
tctggggtgattgtgagactggcacagtgccaagtctatgacatgcgtccagaaatagac
catcagggactgtttggcatgagagatcctcctgtattcattcctgctccagtggatcga
tatcgccagattcttctccctgccctccagttgtgtcaggtcattctcacatccagtatg
gctcagcatctgcaggcagcaggacaggtgttgcagtttctcatctcccattctgacacc
atacaagcaatattacgctgtcaggatgtcagtgcaggctccctgcaagagctagctctt
ctcacaggaatcatcagcaaagctgcattgcctggggtgctaagtgaactagatgttgat
gtcacggaagggtcgttgatggagctacagggacacatagggcgattccagcgccaatgc
ttaggactattaagtcgctttggtggttcagacagacttcggcaatttaagtttcaagat
ggtgtggaaggagatagagtgaacaagaaagatgagattgaattggctatgcaacagatt
tgtgctaatgtcatggaatattgccagtcactcatgttacagagttctccaacattccag
catgcagtatgtctcttcactcctagcctttctgaaactattaacagagatggaccacga
caagatactcaagctccagtggttccatattggcgtctacctggtttgggcattattgtc
tacttgctgaaacaaagtgctaatgatttcttcacttattatgacagtcatcgacagaat
gtcaacaagctacagaatgtagaacagctccccccagatgagataaaagagttgtgccag
tcagtgatgccagctggggtcgataaaatctccacttcccagaagtacatcttggcaaga
cggcgtttggtgaaattgatcaacaatagagctatattgctgtctctttgttcttacatc
atagagacctgcctatttattttttggcgccacctagaatactatctgttacgatgtact
cccactgattgccaagattctctactggcttctacagcttcatttaaaaataggaggcta
caagatacttttacttcagaaacaaacttggatttcagaagtgggttgactcgagtgagc
cagcatgatatagagcagcttcaaattgaagccatcaatgccttcggtgaatcactgcaa
aagaagcttctggatattgaaggattatattccaaagttcgatcccgctattgttttata
caagcacttgtcagacgtatccgtggcttattaaggcaaccaaggggctaa

DBGET integrated database retrieval system