KEGG   Monodelphis domestica (opossum): 100022318Help
Entry
100022318         CDS       T01031                                 

Definition
intestinal-type alkaline phosphatase 1-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100022318
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100022318
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100022318
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 522 aa AA seqDB search
MQGIFALFLVGLYFHTAKGEIPEEEENPSFWNRQAAEAIKTAQQLQPIQTAAKNLILFLG
DGMGVPTVTATRILKGKLSGNLGPETPLAMDRFPYVALSKTYNVDRQVPDSAGTATAYLC
GVKGNYKTIGLSAAARVDQCNSTFGNEVYSVLQRAKKAGKSVGVVTTTRVQHASPSGTYA
HVVNRDWYSDANMPADALRSGCKDIASQLISNVDIDVILGGGRKYMFPVGTPDPEYPNLS
SQNGIRRDDRNLVQEWLDARQGAKYVWDRQELLNAAENLEVTHIMGLFEPGDTKYDLQRN
TSVDPSLMEMTEVAIKILRRNPKGYYLFVEGGRIDHGHHDGNAHLALTEAVMFDSTIDKA
VQMTNEKDTLIAVTADHSHVFSFGGYTYRGSSIFGLAPSKAQDNKAYTSILYGNGPGYVN
GTRPDVKESVSEDVSYKQQAAVPLSSETHGGEDVAIFARGPQAHLFHGVQEETYVAHVMA
FAGCLEPYENCGLSWPNSSLQTSVSFLLLVLVWPFLLLAVQH
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcagggaatattcgctctcttcctggtgggactttatttccacactgccaaaggcgaa
atcccagaagaagaagagaatcccagtttctggaaccggcaagctgcagaagccatcaaa
acagcccagcagttgcagcccatccagacggcagccaagaacctcatcctcttcctggga
gatgggatgggagtgcccacagtgacagccacccggatactcaaaggaaaactgagtgga
aatctgggccctgagacccccctggccatggaccggtttccctatgtggctctgtccaag
acgtacaatgtagacaggcaggtccccgacagcgcaggcacagctaccgcctacctctgt
ggcgtgaagggcaactacaaaaccatcggcctcagcgcggctgcccgggtggaccagtgc
aactcgacctttggcaatgaggtctactctgtactgcaacgagccaagaaagcagggaag
tcagtgggggtagtgaccaccacccgggtgcagcatgcctcgccctctggcacatatgcc
catgtagtaaaccgggactggtactcagatgccaacatgcctgctgacgccctgaggagt
ggttgtaaggacattgcttcccagctgatttccaatgtggacattgatgtgatcctaggt
gggggccgcaagtacatgtttccagtgggaactcctgatcctgaatacccaaacctcagc
agtcagaacgggatcaggagggatgaccggaaccttgtacaggaatggctggacgccaga
cagggagccaaatacgtgtgggaccgtcaagaactactgaatgccgcagaaaacctcgaa
gtgacacatatcatgggcctctttgaaccaggagacactaaatatgatctacagcgcaat
acttctgtagacccctcattgatggagatgactgaggttgccatcaaaatactcaggcga
aatcccaaaggatactacctctttgtggaaggaggtcgaattgaccatggccaccatgat
ggcaatgcacacttggccttgactgaggctgtcatgtttgactcaacaattgataaggct
gtccagatgactaatgaaaaggacactctgattgccgtcactgcggatcattcccatgtc
ttctctttcggcggctacacctacagaggcagctcaatctttggactggctcccagcaag
gcacaagataacaaagcatatacttccatcttatatggcaatggacctggatatgtgaat
ggtaccaggccagatgtcaaagaaagtgtcagtgaggacgtgtcctataagcagcaggca
gctgtgcctctgtcctcagagacccatggaggggaagatgtggccatcttcgcaagaggt
ccccaagcacacctattccatggtgtgcaggaggagacttatgtggctcatgttatggct
tttgctggctgcctggaaccctatgagaactgtgggctctcatggcccaatagtagcctc
cagacatcagtatcattcctgctgctggtccttgtctggcctttcctgctattagcagtt
cagcattga

DBGET integrated database retrieval system