KEGG   Monodelphis domestica (opossum): 100022510Help
Entry
100022510         CDS       T01031                                 

Gene name
FUT7
Definition
fucosyltransferase 7 (alpha (1,3) fucosyltransferase)
Orthology
K07635  
galactoside alpha-1,3-fucosyltransferase 7 [EC:2.4.1.-]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Other types of O-glycan biosynthesis
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100022510 (FUT7)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    100022510 (FUT7)
Enzymes [BR:mdo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     100022510 (FUT7)
Glycosyltransferases [BR:mdo01003]
 Glycan extension
  Lewis blood group
   100022510 (FUT7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 348 aa AA seqDB search
MSAYRLLFSHQAMVGMVLLIALWLLIAHFLSSSRPWDTGIWSLSGVLQPHSKLTVLIWHW
PFNKSLPLDGDVCARYGVADCWLSTNRSLLHRANVVVFHHHELQSGAVRLPLAKRPPGQP
WVWTNLESPSNTHGLSRYRNIFTWVMSYRRDSDIFVPYGELVPRAGPDLPVPAKNRTAAW
VISNYRRTQKRALVYSQLSKYLLIDVFGRASRKPLCAGCLLPTLAPYRFYLAFENSQHPD
YITEKLWRNALSAGVVPVVLGPPRATYEAFLPADSFVHVDDFGSVRDLATFLKSVNASHY
QRFFAWRKRLAVRLYSDWRERFCGVCARYPHLPQGQVYRDLEAWFKSQ
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcctacagactgctcttctcccatcaagccatggttgggatggtactgctcatc
gctctctggctcctgatcgctcatttcctgtcttcaagcaggccatgggacacgggtata
tggtccctgagtggagtcctacagccccactccaaactcacggtccttatctggcactgg
ccctttaacaagtccctgccattggatggtgatgtctgtgctcgctacggcgtggccgac
tgctggctcagcaccaaccgtagcctcctccaccgggccaacgtagtggtcttccaccat
cacgaactccagagcggggccgtccggctgcctttggctaagcggcccccggggcagccc
tgggtatggaccaacctcgagtctccaagcaatactcacgggctttcccgttaccggaac
attttcacctgggtcatgagctaccggagggactctgacatctttgtgccttatggagag
ctggtgccccgagccggccctgatctccccgtgccagccaagaaccgcaccgctgcctgg
gtcatcagtaactaccggcggacgcagaagcgtgcgctagtgtacagccagctgtctaag
tatctcctgatagacgtctttggccgcgccagcaggaagcccctctgcgccggctgcctc
ctgcccacccttgccccctaccgattctacctggcattcgaaaactcccagcacccggac
tacatcaccgagaagctgtggagaaatgccctgagtgccggggtcgtgcctgtggtgctg
ggccctccccgggccacctacgaggccttcttgccggccgattcctttgtgcacgtcgat
gacttcggctccgtccgggacctggccaccttcctgaagagcgtcaacgccagccactat
cagcgcttctttgcctggcgtaaaaggctagctgtgcggctctacagcgactggagggag
cgcttctgcggcgtctgtgcccgctatccccatctgccccagggccaggtctacagggac
ttagaagcctggtttaaatcacaatga

DBGET integrated database retrieval system