KEGG   Monodelphis domestica (opossum): 100022578Help
Entry
100022578         CDS       T01031                                 

Gene name
SIRT6
Definition
sirtuin 6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100022578 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 346 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEIFDPPEELDRKVWELAQLIQRSSNVVFHTGAGISTSSG
IPDFRGPQGVWTMEERGLAPKFDTTFESAQPSKTHMALIQLERVGILKFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECAKCKTQYVRDVVVGSMGLKATGRLCTVAKARGLRACRGE
LRDTILDWEDALPDRDLSLADEACRNADLSITLGTSLQIRPSGNLPLLTKRKGGRLVIVN
LQATKHDRQADLRIHGYVDDVMAKLMKHLCLEIPEWQGPLVVEQAPPLLPLPIQVKAEPP
TLQALPAAPKAEASVQRHRPKQEGGKREQPPATQLPKRLKVEPMPS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaactacgcggccgggctctctccttatgcggacaagggcaagtgcgggctc
cccgagatcttcgacccccctgaagagctagacagaaaagtatgggagctggcacagctg
attcagaggtcttccaatgtggtattccatacaggtgcaggcatcagcacttcctcaggc
atcccagacttcaggggtccccagggtgtgtggaccatggaagaaaggggtctggcaccc
aagtttgacacaacatttgagagtgcccagccttctaagacccacatggccctgattcaa
ctggagcgagtgggcatcttgaaattcctggtgagccagaatgtagatggtttgcacgta
cgctccggcttccccagggacaaactggccgagctccatgggaacatgtttgtggaagaa
tgtgccaagtgtaagacgcagtatgtacgagatgtggtggtgggcagcatgggcctcaag
gcaacaggtcggttgtgcactgtggcaaaggcccgaggtctccgggcctgcaggggggaa
ctgagggacacaatcctggactgggaagatgctctacctgatcgagacctcagccttgct
gatgaagcttgcaggaatgcagatctatccatcacgctgggtacatcactgcagatacga
cccagtggcaacctgcctctgctcactaaacgcaaaggaggccgcttggtcatagtcaac
ctgcaggccaccaaacatgatcgccaggctgaccttcgaattcatggctacgtcgatgat
gtcatggccaagctcatgaagcacctatgcttggagatccctgagtggcaggggcccctt
gtggtggaacaagccccacccctcttaccccttccgatacaggtgaaagctgagcccccc
accctgcaagccctgcctgcagcacccaaggcagaggcctctgtccagcgccacagacca
aagcaggaagggggcaaacgggagcaaccccctgctacccagctgcccaagaggctgaag
gtggaacctatgcccagctga

DBGET integrated database retrieval system