KEGG   Monodelphis domestica (opossum): 100022604Help
Entry
100022604         CDS       T01031                                 

Gene name
HEXDC
Definition
hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100022604 (HEXDC)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100022604 (HEXDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 565 aa AA seqDB search
MHWADPRALEARPWMSQPRKTLDHMRMGCPFPPLPQVRFLCSWGMEPSRGPRTKRPTRAE
SPRLIAKARLNPPSREEPILENLGEKALINIKMSSSSPFKMQLVHLDLKGAPPKVLYLAE
IFPLFHALGANGLLIEYEDMFPYEGPLQLLRARHAYSHSEIKEILHLAKLHDLEVIPLVQ
TFGHMEFVLKHKQFAHLREVELFPNALNPHKEESLALVGTMIDQVMELHKGIRWFHIGCD
EVYYLGEGELSKQWLQQEQNNMVKLCLTQMKAVARHVLIHHPTVKPIVWDDMLRGISEEY
LTESGIAQLVEPMIWDYIEDMDVYGKVLLMDKYRKCGFPKLWVASAFKGATGVNQSLTII
GHHLKNNIQWLKVAESGPTEMLQGIVLTGWQRYDHFSVLCELLPVGIPSLAVCLQALKYG
GYTENVKKIVEKYLGISNLEINSFMSESSGTFPGSDVFALVTQVSFHLRLSVDELLERNR
YVTGWFSPYHRKRKTIHPVMIQYIQPDAISLLARWNAVIQELQAALERIFYPDAIEEWLE
ENIHPTMQKLQQLLKDLDAAIAAHS
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgcattgggcggacccgcgggctctcgaagcccggccctggatgtcccagccccggaag
actttggaccacatgcggatggggtgccccttccccccgctgccgcaagttaggttcctt
tgtagctggggcatggagccttcccggggcccgagaactaagcgccctacaagagcagaa
tccccgaggttaattgccaaagccaggttgaaccctccaagtcgagaagagcccatacta
gagaacttgggagaaaaagcattaataaatatcaaaatgtcaagctcttcaccattcaaa
atgcagctagtacacttggaccttaaaggagctccccccaaggttttatacctggcagag
atcttccctctcttccatgcccttggtgccaatggtctcctcattgaatatgaggacatg
tttccctatgagggacctctacagctcctgagggccaggcacgcctacagccactctgag
atcaaagaaattcttcatttggccaagctacatgacttagaggtgattcccctagtgcaa
acatttggacacatggaatttgttctgaagcataagcaatttgctcacctccgtgaagta
gagctgttcccaaatgctttaaatccccacaaggaggaatccctggcattagtgggtaca
atgattgatcaagtaatggagctacacaaaggcattcgatggttccacataggatgtgat
gaggtatattaccttggtgaaggggaactgtctaaacaatggttacagcaggaacagaac
aatatggtaaaactgtgtctgactcagatgaaagcagttgccaggcatgtgctcatccac
caccccactgttaagcccattgtatgggatgatatgcttagaggcattagtgaagaatat
ctcacagaatctggaatagcacaactggtggagccaatgatctgggactacattgaggat
atggatgtatatggaaaggttctcctcatggataaatacaggaagtgtggattccctaaa
ctgtgggttgccagtgcttttaaaggtgccacaggggtgaatcagtctttgaccattatt
ggccatcatctcaaaaataacatccaatggttgaaagtggccgaaagtggacctactgag
atgctgcaaggaatcgttctaactggttggcaaaggtatgaccatttttctgttctctgt
gaactgcttcctgtgggaatcccatccctagcagtctgtctgcaggcactcaaatatgga
ggttacactgaaaatgttaaaaaaatagtagaaaagtacttagggatatcaaatttggaa
atcaacagttttatgagtgaaagctctgggaccttccctggcagtgatgtcttcgccctg
gtcactcaggtcagctttcacctgaggctctctgtggatgaactgctagaaaggaatagg
tatgtgacaggctggttcagcccttaccaccgcaaaaggaagacgattcaccctgttatg
atccagtacatccagccagatgccataagtctcctagccaggtggaatgctgtcatccag
gagctgcaagcagcacttgagagaattttctacccagatgcaatagaggaatggctggaa
gaaaatatccatcccaccatgcaaaagctacagcagctattgaaagacctagatgcagca
atagcagctcattcttaa

DBGET integrated database retrieval system