KEGG   Monodelphis domestica (opossum): 100022756Help
Entry
100022756         CDS       T01031                                 

Gene name
HDAC2
Definition
histone deacetylase 2
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Cell cycle
Notch signaling pathway
Thyroid hormone signaling pathway
Huntington's disease
Alcoholism
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100022756 (HDAC2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100022756 (HDAC2)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100022756 (HDAC2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100022756 (HDAC2)
   05202 Transcriptional misregulation in cancers
    100022756 (HDAC2)
   05203 Viral carcinogenesis
    100022756 (HDAC2)
   05220 Chronic myeloid leukemia
    100022756 (HDAC2)
  Neurodegenerative diseases
   05016 Huntington's disease
    100022756 (HDAC2)
  Substance dependence
   05034 Alcoholism
    100022756 (HDAC2)
  Infectious diseases
   05169 Epstein-Barr virus infection
    100022756 (HDAC2)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100022756 (HDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 488 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKADVKEEEKSKDNSGEKTDTKGA
KSEQLSNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacagtcagggaggcggcaagaagaaagtctgctactactatgatggtgacatt
ggaaattattattatggacagggtcatcctatgaaaccccataggattcgcatgacccat
aacctgctactaaattatggcttgtatcgaaaaatggaaatatataggccccacaaagct
acagctgaagaaatgaccaagtatcacagtgatgaatacatcaaatttctgcgctcaata
agaccagataatatgtctgagtatagcaagcagatgcaaagatttaatgttggagaagat
tgtccagtgtttgatgggctttttgagttctgccagctgtcaactggtggctctgttgct
ggggcagtaaaattaaatagacaacagactgacatggctgttaactgggctggaggtctt
catcatgcaaagaagtcagaggcatctggtttctgttatgttaatgatattgtccttgcc
atcctagaactgctaaagtaccatcagagagtgctatacattgatattgatatccatcat
ggtgatggtgttgaggaagcattttatacaacagaccgtgtaatgactgtatcattccac
aaatatggtgaatactttccaggcacaggagacttgagggacattggtgcaggaaaaggc
aagtattatgctgtcaactttccaatgagagatggtatagatgatgagtcctatgggcag
atatttaaaccaataatatcgaaagtgatggagatgtatcagcctagtgcagtagtgttg
cagtgtggtgcagactcattatctggtgacagacttggttgtttcaatttaactgtcaaa
ggtcatgctaaatgtgtagaagttgtgaaaactttcaatttgccccttctgatgctggga
ggagggggatacactatccgtaatgttgctcggtgttggacatatgaaactgctgttgcc
ttagattgtgaaattccaaatgaactgccatacaatgattactttgagtattttggacca
gactttaaactgcacataagtccatcaaatatgacaaatcagaataccccagagtatatg
gagaagatcaaacaacgtttgtttgaaaacttgcgcatgttacctcatgcgcctggtgta
cagatgcaagccatccctgaagatgctgttcacgaagacagtggggatgaagatggggaa
gatccagacaaacgaatttctattcgagcatcagacaagcggatagcttgtgatgaagaa
ttttccgattctgaggatgaaggtgaaggagggcgtagaaatgtggctgatcataagaaa
ggagcaaaaaaagcaaggatagaagaagacaagaaggaaacagaagacaaaaaagcagat
gttaaagaagaagaaaagtctaaggacaacagtggtgaaaagacagacaccaaaggagcc
aaatcggaacagctcagcaatccttga

DBGET integrated database retrieval system