KEGG   Monodelphis domestica (opossum): 100022867Help
Entry
100022867         CDS       T01031                                 

Definition
acyl-protein thioesterase 1-like
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:mdo00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 230 aa AA seqDB search
MCGNNMSAPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHVKYICPHAPVMP
VTLNMKMAMPSWFDIIGLSPDSQEDEQGIKQAAENIKALIEQEVKNGIPSHRIILGGFSQ
GGALSLYTALTTQQKLAGVIALSCWLPLRSSFPQGPIGGVNKDISILQCHGDSDPLVPHM
FGSLTVEKLKTLVNPCNVSFSTYDGMMHGSCNQEMLDVKNFIDKILPPVD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtaacaacatgtcggcgccgctccctgccatagtccctgcagctaggaaggca
actgcagcagttatttttcttcatggattaggagacacggggcatggttgggcagaagct
tttgcaggtatcagaagttcacacgtcaaatatatttgtcctcatgcaccagtcatgcct
gttaccttgaatatgaaaatggctatgccttcttggtttgatattattggactctctcct
gactcacaggaggatgaacagggaataaaacaagcggcagaaaatattaaggctttgata
gaacaagaagtaaagaatggaattccatctcatagaattattttgggaggattttctcag
ggaggagctttgtctttgtatactgctcttacaacacagcagaaattggccggtgttata
gctctcagctgttggcttccacttcgatcttcatttccacagggccccattggtggggtt
aataaagatatttctattcttcagtgtcatggagattctgaccctttggttccccatatg
tttggttctctcactgttgaaaagctgaaaacattggtaaatccatgtaatgtaagcttc
agtacctatgatggcatgatgcacggttcatgtaaccaggaaatgttggatgttaagaac
ttcattgataaaatcctacctccagttgactga

DBGET integrated database retrieval system