KEGG   Monodelphis domestica (opossum): 100022921Help
Entry
100022921         CDS       T01031                                 

Definition
histone deacetylase 3-like
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Thyroid hormone signaling pathway
Alcoholism
Viral carcinogenesis
Class
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:mdo04919]
Human Diseases; Cancers; Viral carcinogenesis [PATH:mdo05203]
Human Diseases; Substance dependence; Alcoholism [PATH:mdo05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 428 aa AA seqDB search
MSKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
NQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSXYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPSDLLTYDRTDEADAEERGPEENYTRPEASNEFYDGDHDN
DKESDVEI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagacggtggcctatttctatgacccggatgtggggaacttccactacggggcc
ggtcaccccatgaaaccccatcgtctggcgctcactcatagcctggtgctacactatgga
ctctacaagaagatgatcgtcttcaagccataccaagcatctcagcatgatatgtgccgt
ttccattcagaggattatattgacttcctgcagcgggtcagcccaaccaacatgcagggc
tttactaagagtctcaatgctttcaatgtaggggatgattgccctgtgttcccaggcctc
tttgagttttgttcccgttacacaggtgcttccctgcagggagctacacaattgaacaac
aagatctgtgatattgccattaactgggctggagggctacaccatgctaagaaatttgag
gcctcaggtttctgctatgtcaatgacattgtgatcggcatcctggagctactgaagtat
caccctcgtgtattgtacattgatattgatatccaccatggggatggtgtacaggaagcc
ttctatctcactgaccgagtcatgactgtctctttccataaatatggcaattacttcttt
cctggaacaggtgatatgtatgaagttggagcagaaagtggacgctactactgtctcaac
gtcccccttcgggatggcatcgatgatcagagttacaagcacctcttccagcctgtaatc
aaccaagtggtggatttttaccaaccaacatgcattgtactacagtgtggagctgattcc
ctgggttgtgatcggctgggttgcttcaacctcagcatccgaggtcatggggagtgtgtt
gaatatgtgaagagctttaacatcccattgctggtactgggtggtggtggttatactgtt
cgaaatgttgcccggtgctggacatatgagacatcactgttggtagaagaagctatcagt
gaggagctaccatatagtnnntattttgagtactttgccccagatttcacacttcatcca
gatgtcagcactcgaattgaaaatcagaattcacgacagtacctggatcaaatccgccag
acgatctttgagaatctgaagatgttgaatcatgcacccagtgtccagatccatgatgta
ccatctgatctgctgacctatgacagaactgatgaagctgatgctgaagaaaggggccct
gaggaaaactacaccagaccagaagcttccaatgagttctatgatggagaccatgacaac
gataaagaaagtgacgtagagatttga

DBGET integrated database retrieval system