KEGG   Monodelphis domestica (opossum): 100022968Help
Entry
100022968         CDS       T01031                                 

Definition
tyrosine-protein kinase RYK-like
Orthology
K05128  
RYK receptor-like tyrosine kinase [EC:2.7.10.1]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 627 aa AA seqDB search
MIRAEWPEWQSPPPGRGRGRLPLPEPGLGLRPRGFPPLSPPLPPPPLLPLLLLLLLPVPV
PGVGVPAAAERFPLLLPPAMGPSVSLYLSEEEVHKLLGIDAELYYVRNDLINHYALSFNL
LVPSDTNYLHFTWYAKSKVEYKLGFQIDNPVAMDMPQVNISIQGEVPRTLSVFRVELSCT
GKVDSEIMVLMQLNLTINSSKNFTVLNFKRRKMCYKKLEEVKIPISDKNGNRTIYDPVNA
APTTSTRVFYISVGVCCAVIFLVAIILAVLHLHSMKRIELDDSISESSSSQGLSQPSTQT
TQYLRADTPNNATPVTSYPTLRIEKNDLKSVTLMEAKAKVKDIAISRERITLKDVLQEGT
FGRIFHGVLIDDKDPNKEKQAFVKTVKDQASEIQVTMMLTESCKLRGLHHRNLLPITHVC
IEEGEKPMVLLPYMNWGNLKLFLRQCKLVEANNPQAISQQDLVHMAIQIACGMSYLARRE
VIHKDLAARNCVIDDTLQVKITDNALARDLFPMDYHCLGDNENRPVRWMALESLVNNEFS
SASDVWAFGVTLWELMTLGQTPYVDIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWA
LDPEERPKFQQLVQCLTEFHAALGAYV
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgatcagggccgagtggcccgagtggcagtcgccgccgccaggccgaggccggggccgc
ctcccgctccccgagccgggcctcggcctgcggccccgggggttccctccgctgtctccg
ccgttgccgccgccgccgctgctgccgctgctgctgctgctgctgcttcccgtgcccgtg
ccgggggttggggtccctgccgccgctgagaggttcccgctcctgttgcctccggccatg
gggcccagcgtgagcctctacttgagcgaggaggaggtgcacaaactgctcggtattgat
gcagaactttattatgtgagaaatgatcttattaatcactacgcactatcctttaacctg
ctagtacccagtgacaccaattaccttcacttcacatggtatgcaaaatccaaggttgaa
tataaactgggatttcagatagacaatcctgtggctatggacatgccccaggtcaacatt
tctattcaaggggaagtcccacgcactttatcagtatttcgcgttgaactttcctgcact
ggaaaagtagattctgagataatggtactaatgcaactcaacctgacaataaattcttca
aaaaatttcacagtcttaaatttcaaacgaaggaaaatgtgctacaaaaagcttgaagaa
gtcaaaattccaatttctgacaaaaatggcaacagaactatttatgatcctgtaaatgca
gctcctaccacttctactcgtgtgttttatatcagtgtaggggtttgttgtgcagtaata
ttcctggtagcaataatattagctgttttgcacctgcatagtatgaaaagaattgagctg
gatgacagcatcagtgaaagcagtagttcacaaggtttatcccagccatctacacagaca
actcagtacctgagagctgatactcctaacaatgcaacacctgttaccagttatcctaca
ttacggatagagaagaatgacctaaaaagtgtcactcttatggaggccaaagcaaaggtc
aaggatatagcaatttccagggaacgaataacactaaaggatgttctccaagaaggaact
tttgggcgtattttccatggagttttaatagatgataaagatcccaacaaagaaaaacaa
gcctttgtgaaaactgttaaagatcaagcttctgaaattcaagtgacgatgatgctcact
gaaagctgtaagctccgaggtcttcaccacagaaatctgcttcctatcactcatgtttgt
atagaagaaggagaaaaacctatggtgttattaccatacatgaattggggaaaccttaaa
ttgttcttaagacagtgcaaattagtagaggccaacaatcctcaggcaatttcccagcaa
gatctagtacatatggctattcagattgcctgtggtatgagctatttggcaagaagggag
gtcattcacaaagatttggctgctagaaactgtgtcattgatgatacacttcaggtaaag
atcactgacaatgccctagccagagacttatttcccatggattatcactgtctaggagac
aatgaaaatagaccggttcgatggatggctcttgaaagtttagttaataatgagttctcc
agtgctagtgatgtgtgggcatttggagtaacactatgggaactaatgactttgggccag
accccttatgtggatattgacccctttgagatggctgcttacttaaaagatggctaccga
atagctcagccaatcaattgccctgatgaactgtttgctgttatggcctgttgctgggct
ctagaccctgaggaaagacccaaattccagcagcttgtgcaatgtctcactgaatttcat
gcagctcttggagcctatgtttga

DBGET integrated database retrieval system