KEGG   Monodelphis domestica (opossum): 100023016Help
Entry
100023016         CDS       T01031                                 

Gene name
PRKG1
Definition
protein kinase, cGMP-dependent, type I
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Gap junction
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Class
Cellular Processes; Cell communication; Gap junction [PATH:mdo04540]
Organismal Systems; Digestive system; Salivary secretion [PATH:mdo04970]
Organismal Systems; Nervous system; Long-term depression [PATH:mdo04730]
Organismal Systems; Sensory system; Olfactory transduction [PATH:mdo04740]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:mdo04713]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 711 aa AA seqDB search
MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQA
QQAAQQQAAQQPRGGGGAGGGAGSGAGGGAGGGAGEPRTKRQAISAEPTAFDLQDLSHVT
LPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLV
YVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTI
MMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFI
ISKGTVNVTREDSPSEDPIFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDS
FKHLIGGLDDVSNKAYEDAEAKAKYEAEGAFFANLKLSDFNIIDTLGVGGFGRVELVQLK
SEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEA
CLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKL
VDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSG
PDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFE
GFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgggcacgctgcgagacctgcagtacgcgctccaggagaagatcgaggagctgaggcag
cgcgacgcgctcatcgacgagctcgagctcgagctggaccagaaggacgagctcatccag
aagctgcagaacgagctggacaagtaccgctcggtgatccggcccgccacgcagcaggcg
cagcaggcggcgcagcagcaggcggcacagcagccccgcggcggcggcggcgctggcggc
ggcgcggggagcggcgcggggggcggcgcggggggcggcgcgggcgagccccgcaccaag
cgccaggcgatctccgctgagcccactgccttcgacttgcaggacctcagccacgtgacg
ctgcccttctaccccaagagcccccagtccaaggatcttatcaaggaagccatccttgat
aatgacttcatgaagaacctagagctgtctcagatccaggaaattgtggattgtatgtat
cctgtggagtatggcaaagacagctgcatcatcaaggaaggcgatgtgggctccctggtg
tacgtcatggaagatggaaaagttgaagttaccaaagagggggtgaagctgtgcactatg
ggaccgggcaaagtctttggagaacttgcaattctatacaactgtacccgcacagccacc
gtcaaaactcttgtaaatgtgaaactctgggccatcgatcgacaatgttttcagacaata
atgatgaggacaggtctcatcaagcacacagagtatatggagttcttgaaaagtgttccc
acgttccagagcctccctgaagagattctaagcaagctggctgatgttctggaagagaca
cactatgagaatggggaatatatcatcaggcaaggagcccgaggggacacctttttcatc
attagcaaaggaacggtcaatgtcactcgagaagactccccaagtgaagacccgatcttc
cttcgcactttagggaaaggtgattggtttggagaaaaggccctgcagggggaagatgtg
agaactgccaatgtcattgctgcagaagcagtgacctgccttgtgatcgacagagactcc
ttcaagcacttgattggaggcttggacgacgtttctaataaagcctatgaagacgcagag
gccaaagcaaaatatgaagctgaaggggcattcttcgccaacctgaaactgtcggatttc
aacatcatcgacacactgggagttggaggttttggacgagtcgagctggtccagctgaaa
agtgaagaatcaaaaacatttgccatgaagattcttaagaagcgccacatcgtagacacg
agacagcaggagcacatccgttccgaaaagcagattatgcaaggggctcactcagatttc
attgtcagactctatcggaccttcaaggacagcaaatatctgtacatgctgatggaagcc
tgtctgggtggagagctgtggacgattctcagggacagaggttcatttgaagattcgacg
acgagattttatacagcgtgtgtggtagaagcattcgcctatctgcattccaaaggaatc
atttacagggacctcaagccagaaaacctcattctcgatcaccgaggttatgccaaactg
gttgactttggctttgcaaaaaaaataggatttggaaagaaaacatggacattttgtggg
accccagaatatgtagccccagagatcatcctgaacaaaggtcatgacatttcagcagac
tactggtcgctgggaatcctaatgtatgaactcctgactggcagtccccctttctcaggc
ccggatcctatgaagacctataatatcatattgagaggaattgacatgatagaatttcca
aagaagattgccaaaaatgctgctaatttaattaaaaaactatgcagggacaatccatca
gaaagattaggaaatttgaaaaatggagtaaaagacatccagaagcacaaatggttcgaa
ggctttaactgggaaggcttgagaaaaggaaccttgacgccgcctataatcccgagcgtc
gcatcccccacagatacgagcaactttgacagcttccctgaggacaacgatgaaccgccg
ccggacgacaactcgggatgggacatagacttttaa

DBGET integrated database retrieval system