KEGG   Monodelphis domestica (opossum): 100023016Help
Entry
100023016         CDS       T01031                                 

Gene name
PRKG1
Definition
(RefSeq) protein kinase, cGMP-dependent, type I
  KO
K07376  cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04022  cGMP-PKG signaling pathway
mdo04270  Vascular smooth muscle contraction
mdo04540  Gap junction
mdo04611  Platelet activation
mdo04713  Circadian entrainment
mdo04714  Thermogenesis
mdo04730  Long-term depression
mdo04740  Olfactory transduction
mdo04923  Regulation of lipolysis in adipocytes
mdo04970  Salivary secretion
Module
mdo_M00694  cGMP signaling
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100023016 (PRKG1)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    100023016 (PRKG1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100023016 (PRKG1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100023016 (PRKG1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100023016 (PRKG1)
  Digestive system
   04970 Salivary secretion
    100023016 (PRKG1)
  Nervous system
   04730 Long-term depression
    100023016 (PRKG1)
  Sensory system
   04740 Olfactory transduction
    100023016 (PRKG1)
  Environmental adaptation
   04713 Circadian entrainment
    100023016 (PRKG1)
   04714 Thermogenesis
    100023016 (PRKG1)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100023016 (PRKG1)
Protein kinases [BR:mdo01001]
 Serine/threonine kinases: AGC group
  PKG family
   100023016 (PRKG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase cNMP_binding Pkinase_Tyr Kinase-like Med4 RhlB APH Pkinase_C DUF4200 PKcGMP_CC Spc42p
Motif
Other DBs
NCBI-GeneID: 100023016
NCBI-ProteinID: XP_001374685
Position
1
AA seq 711 aa AA seqDB search
MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQA
QQAAQQQAAQQPRGGGGAGGGAGSGAGGGAGGGAGEPRTKRQAISAEPTAFDLQDLSHVT
LPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLV
YVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTI
MMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFI
ISKGTVNVTREDSPSEDPIFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDS
FKHLIGGLDDVSNKAYEDAEAKAKYEAEGAFFANLKLSDFNIIDTLGVGGFGRVELVQLK
SEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEA
CLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKL
VDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSG
PDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFE
GFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgggcacgctgcgagacctgcagtacgcgctccaggagaagatcgaggagctgaggcag
cgcgacgcgctcatcgacgagctcgagctcgagctggaccagaaggacgagctcatccag
aagctgcagaacgagctggacaagtaccgctcggtgatccggcccgccacgcagcaggcg
cagcaggcggcgcagcagcaggcggcacagcagccccgcggcggcggcggcgctggcggc
ggcgcggggagcggcgcggggggcggcgcggggggcggcgcgggcgagccccgcaccaag
cgccaggcgatctccgctgagcccactgccttcgacttgcaggacctcagccacgtgacg
ctgcccttctaccccaagagcccccagtccaaggatcttatcaaggaagccatccttgat
aatgacttcatgaagaacctagagctgtctcagatccaggaaattgtggattgtatgtat
cctgtggagtatggcaaagacagctgcatcatcaaggaaggcgatgtgggctccctggtg
tacgtcatggaagatggaaaagttgaagttaccaaagagggggtgaagctgtgcactatg
ggaccgggcaaagtctttggagaacttgcaattctatacaactgtacccgcacagccacc
gtcaaaactcttgtaaatgtgaaactctgggccatcgatcgacaatgttttcagacaata
atgatgaggacaggtctcatcaagcacacagagtatatggagttcttgaaaagtgttccc
acgttccagagcctccctgaagagattctaagcaagctggctgatgttctggaagagaca
cactatgagaatggggaatatatcatcaggcaaggagcccgaggggacacctttttcatc
attagcaaaggaacggtcaatgtcactcgagaagactccccaagtgaagacccgatcttc
cttcgcactttagggaaaggtgattggtttggagaaaaggccctgcagggggaagatgtg
agaactgccaatgtcattgctgcagaagcagtgacctgccttgtgatcgacagagactcc
ttcaagcacttgattggaggcttggacgacgtttctaataaagcctatgaagacgcagag
gccaaagcaaaatatgaagctgaaggggcattcttcgccaacctgaaactgtcggatttc
aacatcatcgacacactgggagttggaggttttggacgagtcgagctggtccagctgaaa
agtgaagaatcaaaaacatttgccatgaagattcttaagaagcgccacatcgtagacacg
agacagcaggagcacatccgttccgaaaagcagattatgcaaggggctcactcagatttc
attgtcagactctatcggaccttcaaggacagcaaatatctgtacatgctgatggaagcc
tgtctgggtggagagctgtggacgattctcagggacagaggttcatttgaagattcgacg
acgagattttatacagcgtgtgtggtagaagcattcgcctatctgcattccaaaggaatc
atttacagggacctcaagccagaaaacctcattctcgatcaccgaggttatgccaaactg
gttgactttggctttgcaaaaaaaataggatttggaaagaaaacatggacattttgtggg
accccagaatatgtagccccagagatcatcctgaacaaaggtcatgacatttcagcagac
tactggtcgctgggaatcctaatgtatgaactcctgactggcagtccccctttctcaggc
ccggatcctatgaagacctataatatcatattgagaggaattgacatgatagaatttcca
aagaagattgccaaaaatgctgctaatttaattaaaaaactatgcagggacaatccatca
gaaagattaggaaatttgaaaaatggagtaaaagacatccagaagcacaaatggttcgaa
ggctttaactgggaaggcttgagaaaaggaaccttgacgccgcctataatcccgagcgtc
gcatcccccacagatacgagcaactttgacagcttccctgaggacaacgatgaaccgccg
ccggacgacaactcgggatgggacatagacttttaa

DBGET integrated database retrieval system