KEGG   Monodelphis domestica (opossum): 100023066Help
Entry
100023066         CDS       T01031                                 

Definition
ribonuclease pancreatic-like
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     100023066
Messenger RNA biogenesis [BR:mdo03019]
 Eukaryotic Type
  mRNA degradation factors
   Other degradation factors
    RNases
     100023066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 150 aa AA seqDB search
MALKGSHLMLLLLGLFLAELVHQSTGKESPSKKFQRQHMDPENSASDDTKYCDHMMKARN
MTKGRCKPVNTFIHEPKEIVDAVCRETNITCKNGQSNCYQSSQPMSLTHCRQTGASKYPN
CQYRGSDITKQIIVACEGNPYVPVHFDAYV
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaagggctcccacctaatgctcctcctgttggggctgttcctagcagagctg
gtccaccaatcgactggcaaagagtccccctcaaagaagtttcagcggcagcacatggat
ccagagaattcggcctccgatgacactaaatactgcgaccacatgatgaaggccaggaac
atgaccaaagggagatgcaaaccagtcaataccttcatacacgagcctaaggaaatagtc
gatgccgtctgcagggagactaacatcacctgcaagaatgggcagtccaattgttaccag
agtagccagcctatgtccctcacccactgccgccagactggagcctccaaataccccaac
tgccagtaccggggttctgatatcactaaacaaatcattgtggcctgtgagggaaacccc
tatgtgcccgtgcattttgatgcttatgtgtag

DBGET integrated database retrieval system