KEGG   Monodelphis domestica (opossum): 100023149Help
Entry
100023149         CDS       T01031                                 

Definition
(RefSeq) cytochrome P450 2C19-like
  KO
K17721  cytochrome P450 family 2 subfamily C polypeptide 19 [EC:1.14.14.51 1.14.14.52 1.14.14.53 1.14.14.-]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00590  Arachidonic acid metabolism
mdo00591  Linoleic acid metabolism
mdo00982  Drug metabolism - cytochrome P450
mdo01100  Metabolic pathways
mdo04726  Serotonergic synapse
mdo05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100023149
   00591 Linoleic acid metabolism
    100023149
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100023149
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100023149
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100023149
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.51  (S)-limonene 6-monooxygenase
     100023149
    1.14.14.52  (S)-limonene 7-monooxygenase
     100023149
    1.14.14.53  (R)-limonene 6-monooxygenase
     100023149
    1.14.14.-  
     100023149
Cytochrome P450 [BR:mdo00199]
 Cytochrome P450, animal type
  CYP2 family
   100023149
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100023149
NCBI-ProteinID: XP_007478828
Ensembl: ENSMODG00000005361
Position
1
AA seq 497 aa AA seqDB search
MDPSVVTALGLIFCVSCLLLISAWRKGFGKGKLPPGPTPLPIIGNLLQLDTKNINKSFCE
LAKTYGSVFTLYLGSERAVVLHGQKAVKEALIGNGDAFAGRGSFPISETINKGLGLLFSN
GERWKQIRRFSLMTLRNFGMGKRSIEERVQEEAKRLVEALKNTNGLPCDPTFIFGCAPCN
VICSVVFQKHFEYQDKKFLTLMEYLNENLQILSSPWIQVYNLFPSLIHHLPGIHHKVIKN
FRALNDFVLERVKEHQETVDPNDPRDFIDCFLMKMEQEKQNPKSEFIIENLVSTTIDLFG
AGTETTSTTLRYGFLLLLKHPQIVDKIREEMDQVIGQNRSPCMKDRSSMPYTDAVIHEIQ
RYIDLVPTSLPHAVTQDVKFRQYLIPKGTTIIPLLTSVLYDNEEFPNPEQFDPGHFLDES
GNFKKSDYFVPFSIGKRACVGESLAQMELFLFFTTILQNFTLKPLVDPKDIDVTPISNGF
NHVPPCYELCFLPSQNM
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggacccatctgtagtcactgctcttggtctgatattctgtgtgtcatgtctgctactc
atttcggcatggagaaagggctttggaaaaggaaaactcccacctgggcctactcctctt
ccaattattggaaatctgctgcagttagatactaagaatataaacaaatccttttgcgag
ctggcaaaaacctatggttcggtattcactctgtacttgggttctgagcgtgctgttgtg
ttacatggacaaaaggcagtcaaggaagctctgattggtaatggagatgcatttgctggc
agaggaagcttcccaatatctgaaaccattaacaagggattgggactgcttttcagtaat
ggagagagatggaagcaaattcgtcgcttctccctcatgaccctgaggaatttcggtatg
gggaagaggagcattgaggagcgagtccaagaagaagcaaagcgcctggtcgaggcatta
aaaaacacaaacggattgccttgtgaccccacattcatctttgggtgtgctccctgcaat
gtcatctgctcagttgttttccagaaacattttgaatatcaagacaagaaatttctaact
ttaatggaatatttaaatgaaaacctccaaattctcagctccccatggatacaggtctac
aatcttttcccaagtctaatccatcatcttccaggaattcatcataaagtaattaaaaac
tttcgtgcactgaatgattttgttttggagagggtaaaggaacaccaagaaaccgtggac
cccaatgaccctcgggacttcattgactgtttcctgatgaaaatggagcaggaaaagcaa
aatccaaagtctgaatttatcattgagaacttggtctccaccactattgatctctttgga
gcaggaacagagacaactagcaccaccctaagatatggcttcctgcttctgctgaagcac
cctcagatagtagacaaaatccgtgaagaaatggaccaagtgattggccaaaaccgaagc
ccctgcatgaaagacagaagcagtatgccttatacggatgctgtaatccatgaaattcag
agatacattgaccttgtccccaccagcctgcctcatgcagtcacccaagatgttaagttc
agacaatacctcatccccaagggcacgaccatcataccattactgacttctgttctgtat
gacaatgaagagttccccaatccagagcagtttgacccaggccatttcctggatgaaagt
ggcaactttaagaaaagcgactattttgtacctttttcaataggaaaacgggcatgtgtt
ggtgaaagcctggctcagatggagttgttcctcttttttactactatcttacaaaatttt
accttgaagcctcttgttgacccaaaagacattgacgtcactccaatttccaacgggttt
aaccatgtgccgccttgttatgagctctgcttcctaccttcccagaacatgtaa

DBGET integrated database retrieval system