KEGG   Monodelphis domestica (opossum): 100023225Help
Entry
100023225         CDS       T01031                                 

Gene name
ARG2
Definition
(RefSeq) arginase 2
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00220  Arginine biosynthesis
mdo00330  Arginine and proline metabolism
mdo01100  Metabolic pathways
mdo01230  Biosynthesis of amino acids
mdo05146  Amoebiasis
Module
mdo_M00029  Urea cycle
mdo_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    100023225 (ARG2)
   00330 Arginine and proline metabolism
    100023225 (ARG2)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    100023225 (ARG2)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100023225 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 100023225
NCBI-ProteinID: XP_001370052
Ensembl: ENSMODG00000009978
Position
1
AA seq 426 aa AA seqDB search
MGGDCGEGVPEACGRRSFEARARDAVWEGAECYRLRARGGTRNEVKRDRRSGIKRTRFLF
PVASSAAGLLSVMSLRSSLSRLFQKQAHSAFKKSVHSVAVIGAPFSKGQKRRGVEHGPSA
IREAGLLKRLSNLGCRVNDLGDLSFTPVASDECYNNLIVNPRSVGLANQELAEAVSRAVS
SGHRCITVGGDHSLAIGSISGHVRHCPDLCVIWVDAHADINTPLTTLSGSLHGQPVSFLL
RELQDKVPSLPGFSWIKPCLSSPDIVYIGLRDVDPAEHFILKNYDILYFSMRDIDRLGIQ
KVMEQTFDQLISKKQRPIHLSFDIDAFDPSLAPATGTPVVGGLTYREGMYITEEVHNTGL
LSALDLVEVNPLLATSEEDVKATAGLAVDVIASSFGQKRAGGHSGYDQLPTPSSPDESDN
EERVRI
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgggcggggactgtggagaaggtgtgccggaggcctgcgggaggcggagcttcgaggct
agagcccgtgacgcggtctgggagggggcggagtgttaccggctccgagctcgcggaggt
acccgaaacgaggtaaagcgagaccgtcgtagcggtataaaaaggacccgcttcttattc
ccggttgcttcttctgcagctggcctgttatcagtcatgtctttgaggagcagtctctcg
aggctttttcagaagcaagctcattccgcattcaagaaatccgttcactcggtggctgtg
atcggagctccgttctccaaggggcagaaacgaagaggagtagaacatggtccttcagcc
ataagagaggcagggttattgaaaaggctctccaacttgggttgccgggtgaatgacttg
ggagatctgagtttcactcctgtggccagtgatgagtgctacaataacctaattgtgaat
cctcgatcagtgggccttgccaaccaagaattggctgaggcagttagcagggctgtctct
tctggtcaccgctgcatcactgtgggaggagaccacagtttggcaattggttccattagt
ggccatgttcggcactgcccagacttgtgtgttatctgggttgacgctcatgctgatatc
aacacaccccttaccactttgtcagggagtctgcatggacagccagtctccttcctcctt
agagaactacaggacaaggtaccatctctcccaggattctcttggatcaagccctgtctc
tcatccccagatattgtgtatattggcctaagagatgtggatcctgctgaacattttatt
ctaaaaaattatgacattttatacttttcaatgagagatattgatcgtcttggaatccag
aaggtcatggaacagacatttgaccaactgatcagcaaaaaacaacgaccaattcatctg
agctttgacattgatgctttcgacccttcgctggctccagcaacagggactcctgttgtg
ggtgggctgacttatcgagaaggcatgtacattactgaggaggtacataatacaggtttg
ctgtcggccctggatctagttgaagtcaatcctctcttggctacttcggaggaggatgtg
aaggccacagcggggctagctgtggatgtgattgcctcaagctttggccagaagagggca
ggagggcacagtggctatgatcagcttcctactcccagttcaccagatgaatcagacaat
gaagaacgcgttcgaatttag

DBGET integrated database retrieval system