KEGG   Monodelphis domestica (opossum): 100023225Help
Entry
100023225         CDS       T01031                                 

Gene name
ARG2
Definition
(RefSeq) arginase 2
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100023225 (ARG2)
  Amino acid metabolism
   00220 Arginine biosynthesis
    100023225 (ARG2)
   00330 Arginine and proline metabolism
    100023225 (ARG2)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    100023225 (ARG2)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100023225 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 426 aa AA seqDB search
MGGDCGEGVPEACGRRSFEARARDAVWEGAECYRLRARGGTRNEVKRDRRSGIKRTRFLF
PVASSAAGLLSVMSLRSSLSRLFQKQAHSAFKKSVHSVAVIGAPFSKGQKRRGVEHGPSA
IREAGLLKRLSNLGCRVNDLGDLSFTPVASDECYNNLIVNPRSVGLANQELAEAVSRAVS
SGHRCITVGGDHSLAIGSISGHVRHCPDLCVIWVDAHADINTPLTTLSGSLHGQPVSFLL
RELQDKVPSLPGFSWIKPCLSSPDIVYIGLRDVDPAEHFILKNYDILYFSMRDIDRLGIQ
KVMEQTFDQLISKKQRPIHLSFDIDAFDPSLAPATGTPVVGGLTYREGMYITEEVHNTGL
LSALDLVEVNPLLATSEEDVKATAGLAVDVIASSFGQKRAGGHSGYDQLPTPSSPDESDN
EERVRI
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgggcggggactgtggagaaggtgtgccggaggcctgcgggaggcggagcttcgaggct
agagcccgtgacgcggtctgggagggggcggagtgttaccggctccgagctcgcggaggt
acccgaaacgaggtaaagcgagaccgtcgtagcggtataaaaaggacccgcttcttattc
ccggttgcttcttctgcagctggcctgttatcagtcatgtctttgaggagcagtctctcg
aggctttttcagaagcaagctcattccgcattcaagaaatccgttcactcggtggctgtg
atcggagctccgttctccaaggggcagaaacgaagaggagtagaacatggtccttcagcc
ataagagaggcagggttattgaaaaggctctccaacttgggttgccgggtgaatgacttg
ggagatctgagtttcactcctgtggccagtgatgagtgctacaataacctaattgtgaat
cctcgatcagtgggccttgccaaccaagaattggctgaggcagttagcagggctgtctct
tctggtcaccgctgcatcactgtgggaggagaccacagtttggcaattggttccattagt
ggccatgttcggcactgcccagacttgtgtgttatctgggttgacgctcatgctgatatc
aacacaccccttaccactttgtcagggagtctgcatggacagccagtctccttcctcctt
agagaactacaggacaaggtaccatctctcccaggattctcttggatcaagccctgtctc
tcatccccagatattgtgtatattggcctaagagatgtggatcctgctgaacattttatt
ctaaaaaattatgacattttatacttttcaatgagagatattgatcgtcttggaatccag
aaggtcatggaacagacatttgaccaactgatcagcaaaaaacaacgaccaattcatctg
agctttgacattgatgctttcgacccttcgctggctccagcaacagggactcctgttgtg
ggtgggctgacttatcgagaaggcatgtacattactgaggaggtacataatacaggtttg
ctgtcggccctggatctagttgaagtcaatcctctcttggctacttcggaggaggatgtg
aaggccacagcggggctagctgtggatgtgattgcctcaagctttggccagaagagggca
ggagggcacagtggctatgatcagcttcctactcccagttcaccagatgaatcagacaat
gaagaacgcgttcgaatttag

DBGET integrated database retrieval system