KEGG   Monodelphis domestica (opossum): 100023231Help
Entry
100023231         CDS       T01031                                 

Gene name
USP48
Definition
ubiquitin specific peptidase 48
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 1036 aa AA seqDB search
MAPRLQLEKAAWRWAETVRPEEVSQEHIEAAYRIWLEPCIRGVCRRNCKGNPNCLVGIGE
HVWLGEIDENSFHNIDDPNSERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLC
PSTCGDHMMGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQ
DAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTVCNQCGRESKLLSKFYELE
LNIQGHKQLTDCITEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFV
FDRQTGHKKKLNTYIGFSELLDMEPYMEHKEGIYVYELSAVLIHRGVSAYSGHYIAHVKD
PQTGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCSRNAYMLVYRL
QTQEKSSLTVQVPAFLQELVDRDNSKFEEWCVEMAEMRKQSVDKGKAKHEEVKELYQRLP
AGAEPYEFVSLEWLQKWLDESTPTKPIDNHACLCAHDKLHPDKISIMKRISEYAADIFYS
RYGGGPRLNVKALCKDCVVERCRVLRLKNQLNEDYKIVTNLLKTNVKGTEGFWVGKSSLR
SWRQLALEQLDEQDIDTDQSNGKMNGDTLNKDDSKDDKKDEEEELSFNEDILCPHGNLCI
TENERRLVSKEAWGKLQQYFPKAPEFASYKECCSQCKILEREGEENEALHKMIANEQKTS
LPNLFQDKNRPCLSNWPQETDVLYIVSQFFVEEWRKFVRRPTRCTPVSSVGNSALLCPHG
GLMFTFASMTKEDSKLIALIWPNEWEMIQKLFVVDHVIKIIKTETDDANPSQILYTSEPS
LCPECREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDAAPELNVSSSETEEDREETRP
EGEKDPDFNQTNGGTKRQKISHQNYIVYQKQVIRRSMRHRKVRGEKALLVSANQTLKELK
IQIMHAFSVAPFDQNLSIDGKVLNDDTATLGTLGVIPESVILLKADEPIADYAAMDDVMQ
VCMPEEGFKGTGLLGH
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atggccccgcggctgcagctggagaaggccgcctggcgatgggcggagacggtgcggccc
gaggaggtgtcgcaggagcacatcgaggcggcctaccgcatctggttggagccctgcatc
cggggcgtgtgcagaagaaactgcaaagggaacccaaattgcttggttggaattggagaa
cacgtctggttaggggaaattgatgaaaacagctttcacaacatagatgatccgaactct
gaaagaaggaaaaagaactcatttgtgggtctaacaaaccttggagcaacctgctatgtg
aacacttttcttcaagtttggtttcttaacctggagcttagacaggctttgtatttatgt
ccaagtacctgtggtgaccatatgatgggagatggtattcaggaagagaaagattatgaa
cctcagaccatttgtgaacatctccagtacctgtttgctttgctccagaacagtaacaga
aggtacattgatccatcaggatttgttaaagccttaggcttggacacaggacaacaacag
gatgcccaagagttttcaaagctatttatgtctttattggaggatactttgtctaagcag
aagaatccagatgtacggaacattgtccaacagcaattttgtggggaatatgcatatgtc
accgtctgtaaccaatgtggccgtgaatctaagcttttatcaaaattttatgaactggag
ttaaatatccaagggcacaagcaattaacggattgcatcaccgaatttctcaaggaagaa
aaattagaaggagacaatcgatacttctgtgaaaactgccagagtaaacagaatgcaacc
aggaagataagactactcagtcttccttgtacacttaatttacagctaatgcgttttgtg
tttgacagacaaactggacataagaaaaagctgaatacctacattggcttctcagaactt
ttggatatggaaccttacatggagcataaagaaggtatctacgtttatgaactcagtgct
gtcctcatacaccgaggagtaagtgcatattctggtcactacattgctcatgtgaaggac
cctcagactggagaatggtataagttcaacgatgaagacatagaaaagatggagggaaag
aaattacaactagggattgaggaagatctagcagagccttccaagtcacagactaggaag
cctaaatgtgggaaaggaactcactgctctagaaatgcatacatgttggtgtatagatta
cagactcaagagaaatcttctctgacggttcaagtaccagcttttctacaagagctggta
gaccgtgataactccaagtttgaggagtggtgtgttgaaatggcggaaatgcgtaaacaa
agtgtggacaaaggcaaagccaaacacgaagaggtgaaggaactctaccaaaggttacct
gctggagctgagccatatgaatttgtctcacttgaatggctgcagaagtggttagatgaa
tcaacccctacaaagcccattgataaccatgcctgtctatgcgcccatgacaagctgcat
cctgacaaaatatcaatcatgaagagaatctctgaatatgcagctgacattttctacagt
cgctatggagggggaccccggcttaatgttaaagccctttgcaaagattgtgtggtagaa
cgctgtcgggtgttgcgattgaagaaccaactaaatgaagactataagattgttacaaat
ttgctgaaaactaatgtgaaaggtactgaaggcttttgggtaggaaaatcttccttgaga
agttggcgacaattagccctggagcagttagatgagcaagatattgatacagaccaaagt
aatgggaaaatgaatggtgataccttaaataaagatgactccaaggatgataaaaaagat
gaagaagaggaattaagttttaatgaagacatcctgtgcccacatggtaatttatgtata
acagaaaatgagaggcggcttgtttctaaagaggcttgggggaaactacagcaatacttt
ccaaaagctccagaatttgcaagttacaaagaatgctgttcccagtgtaagatcctggaa
agagaaggagaagaaaatgaagctttacataagatgattgcaaatgaacaaaaaacttct
ctcccgaacttgttccaagacaaaaatagaccttgtcttagtaactggcctcaggagacg
gatgtgctttacattgtgtcccaattttttgttgaagaatggcggaaatttgtgaggcgg
cctacaagatgtacccctgtatcatcagtaggaaacagtgcccttctctgccctcatggt
ggacttatgtttacttttgcttccatgaccaaagaagattctaaacttatagctctcata
tggcccaatgagtgggagatgatacaaaagctattcgtcgtggatcatgtaatcaaaatt
atcaaaactgaaacagatgatgcaaatccttcacagatactgtatacttctgagcctagt
ctttgtccagaatgcagggaagggttattgtgtcagcagcagcgggatctgcgtgaatat
actcaagccactatatatgtacataaagttgtggataataaaaaggtaatgaaggatgca
gctccagaattgaatgttagtagttcagaaactgaagaggacagggaggagaccaggcca
gaaggggaaaaagacccggactttaatcagaccaatggtggaacaaagaggcaaaaaata
tcccaccagaattatattgtttatcagaagcaggttattcgacggagcatgaggcaccgg
aaagttcggggagaaaaagcactacttgtttcagctaatcagacattaaaagaactaaaa
atccagatcatgcacgccttttcagtagctccttttgaccagaatctctcaattgatggg
aaagtcctaaatgatgacaccgcaaccctgggtacccttggcgtcattcctgaatcagtt
attttgttaaaggcagatgaaccaatagcagattatgcagcaatggatgatgttatgcaa
gtatgtatgcctgaagagggatttaaagggactggtctccttggacattaa

DBGET integrated database retrieval system