KEGG   Monodelphis domestica (opossum): 100023235Help
Entry
100023235         CDS       T01031                                 

Definition
(RefSeq) cytochrome P450 2C19-like
  KO
K07413  cytochrome P450 family 2 subfamily C [EC:1.14.14.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00140  Steroid hormone biosynthesis
mdo00590  Arachidonic acid metabolism
mdo00591  Linoleic acid metabolism
mdo00830  Retinol metabolism
mdo01100  Metabolic pathways
mdo04726  Serotonergic synapse
mdo04750  Inflammatory mediator regulation of TRP channels
mdo05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100023235
   00590 Arachidonic acid metabolism
    100023235
   00591 Linoleic acid metabolism
    100023235
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100023235
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100023235
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100023235
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100023235
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100023235
Cytochrome P450 [BR:mdo00199]
 Cytochrome P450, animal type
  CYP2 family
   100023235
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100023235
NCBI-ProteinID: XP_001374840
Ensembl: ENSMODG00000005516
UniProt: F7G5J4
Position
1
AA seq 497 aa AA seqDB search
MGPSVVTALGLLFCISCLLLILSWRKGFGKGKLPPGPVPLPIIGNMLQLNLKNIPESLCM
LAKEYGPVFTLQLGVQRIVVLHGYKAVKEALIEHGEQFAARGPMPIFELVSNGFGIGVSN
GERWKQLRRFSLMTLRNFGMGKRSIEERVQGEAKFLVEELKKTKGLPCDPTFILGCAPCN
VICSLIFQKHFEYNDQKFLYLMKLLHEQVRIGSSAWIQFYNCFPSLVQHLPGPHRKLLKL
FHFLHTFILEEIKEHQGTLDPSNPRDLIDCFLMKMEQEKQQPLSEFNIDNLVNTVADLFG
AGTETTSTTLRYGLLMLLKHPEITEKIHEEIDRVIGHNRSPCMEDRNKMPYTNAVVHEIQ
RYIDLIPTSLPHLVTEDTQFRQYIIPKGTTIIPFLSSVLYDEKEFPNPNQFDPGHFLDEN
GNFKKSDYFMPFSTGKRICLGEGLARMELFLFFTTILQNFTLKSLIDPKDIDTTPIDSGF
GKIPPSYKLCFLPSQNM
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgggtccatctgtggtcactgcacttggtttactgttctgtatatcttgtctgcttctc
attttgtcatggagaaaaggctttggaaaaggaaagcttccacctggtcctgttcctctt
cccattattggtaatatgctgcagttgaacctgaagaatatccctgaatctctttgcatg
ctagcaaaggagtatggaccagttttcactctgcaattgggtgttcagcgaattgttgtg
ttacatggatacaaggcagtgaaagaagctctgattgagcatggagaacagtttgctgcc
cgaggacctatgccaatttttgaattggtttccaatggatttggaattggtgtaagcaat
ggagagagatggaagcaacttcgccgattctccctgatgaccttgaggaattttgggatg
gggaagaggagcattgaggaacgagtccaaggagaggcaaagttccttgtggaggagtta
aaaaaaaccaaaggattaccatgcgaccccacattcatccttgggtgtgctccttgcaat
gtaatctgctctctcattttccagaaacactttgaatataatgaccagaaatttctatat
ttaatgaagcttttacatgaacaggtcaggattgggagttctgcatggattcagttctat
aattgttttccatctttggtacaacacctccctggacctcatcgcaagctattaaaactt
tttcattttttacatacatttattttggaagaaatcaaggaacaccaagggacactggac
cccagtaatcccagggatttaattgactgttttctgatgaaaatggagcaggaaaagcaa
caaccactgtctgaatttaacattgacaacttggtcaatactgtagctgatctctttggt
gcaggaacagaaacaacaagcaccaccctgagatatggattgttgatgctcttgaaacac
cctgagataacagaaaaaattcatgaagaaatagatcgtgtgattggtcacaatagaagt
ccctgcatggaggacagaaacaagatgccttacactaatgctgtggtccatgaaatacag
agatacattgatctcattccaaccagcctgcctcatcttgttactgaagatacacagttc
cgacaatatattattcccaagggtaccaccataataccattcctgtcttctgttctgtat
gatgaaaaagagttccccaatccaaaccagtttgaccctggtcacttcctggatgaaaat
ggcaactttaagaagagtgactatttcatgcccttttcaacaggaaaacggatatgtctt
ggtgagggcttggctcgaatggaattatttctgtttttcactaccatcctacagaatttt
accttgaaatctctcattgacccaaaagatatcgataccactccaattgacagtggattt
ggcaaaatacccccctcctataagctctgcttcctaccttcccaaaacatgtga

DBGET integrated database retrieval system