KEGG   Monodelphis domestica (opossum): 100023235Help
Entry
100023235         CDS       T01031                                 

Definition
cytochrome P450 2C19-like
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mdo00140]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mdo00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:mdo00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:mdo00830]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:mdo04726]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:mdo04750]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:mdo05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 497 aa AA seqDB search
MGPSVVTALGLLFCISCLLLILSWRKGFGKGKLPPGPVPLPIIGNMLQLNLKNIPESLCM
LAKEYGPVFTLQLGVQRIVVLHGYKAVKEALIEHGEQFAARGPMPIFELVSNGFGIGVSN
GERWKQLRRFSLMTLRNFGMGKRSIEERVQGEAKFLVEELKKTKGLPCDPTFILGCAPCN
VICSLIFQKHFEYNDQKFLYLMKLLHEQVRIGSSAWIQFYNCFPSLVQHLPGPHRKLLKL
FHFLHTFILEEIKEHQGTLDPSNPRDLIDCFLMKMEQEKQQPLSEFNIDNLVNTVADLFG
AGTETTSTTLRYGLLMLLKHPEITEKIHEEIDRVIGHNRSPCMEDRNKMPYTNAVVHEIQ
RYIDLIPTSLPHLVTEDTQFRQYIIPKGTTIIPFLSSVLYDEKEFPNPNQFDPGHFLDEN
GNFKKSDYFMPFSTGKRICLGEGLARMELFLFFTTILQNFTLKSLIDPKDIDTTPIDSGF
GKIPPSYKLCFLPSQNM
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgggtccatctgtggtcactgcacttggtttactgttctgtatatcttgtctgcttctc
attttgtcatggagaaaaggctttggaaaaggaaagcttccacctggtcctgttcctctt
cccattattggtaatatgctgcagttgaacctgaagaatatccctgaatctctttgcatg
ctagcaaaggagtatggaccagttttcactctgcaattgggtgttcagcgaattgttgtg
ttacatggatacaaggcagtgaaagaagctctgattgagcatggagaacagtttgctgcc
cgaggacctatgccaatttttgaattggtttccaatggatttggaattggtgtaagcaat
ggagagagatggaagcaacttcgccgattctccctgatgaccttgaggaattttgggatg
gggaagaggagcattgaggaacgagtccaaggagaggcaaagttccttgtggaggagtta
aaaaaaaccaaaggattaccatgcgaccccacattcatccttgggtgtgctccttgcaat
gtaatctgctctctcattttccagaaacactttgaatataatgaccagaaatttctatat
ttaatgaagcttttacatgaacaggtcaggattgggagttctgcatggattcagttctat
aattgttttccatctttggtacaacacctccctggacctcatcgcaagctattaaaactt
tttcattttttacatacatttattttggaagaaatcaaggaacaccaagggacactggac
cccagtaatcccagggatttaattgactgttttctgatgaaaatggagcaggaaaagcaa
caaccactgtctgaatttaacattgacaacttggtcaatactgtagctgatctctttggt
gcaggaacagaaacaacaagcaccaccctgagatatggattgttgatgctcttgaaacac
cctgagataacagaaaaaattcatgaagaaatagatcgtgtgattggtcacaatagaagt
ccctgcatggaggacagaaacaagatgccttacactaatgctgtggtccatgaaatacag
agatacattgatctcattccaaccagcctgcctcatcttgttactgaagatacacagttc
cgacaatatattattcccaagggtaccaccataataccattcctgtcttctgttctgtat
gatgaaaaagagttccccaatccaaaccagtttgaccctggtcacttcctggatgaaaat
ggcaactttaagaagagtgactatttcatgcccttttcaacaggaaaacggatatgtctt
ggtgagggcttggctcgaatggaattatttctgtttttcactaccatcctacagaatttt
accttgaaatctctcattgacccaaaagatatcgataccactccaattgacagtggattt
ggcaaaatacccccctcctataagctctgcttcctaccttcccaaaacatgtga

DBGET integrated database retrieval system