KEGG   Monodelphis domestica (opossum): 100023348Help
Entry
100023348         CDS       T01031                                 

Gene name
MGEA5
Definition
meningioma expressed antigen 5 (hyaluronidase)
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 919 aa AA seqDB search
MVQKENQAALEERESELTPNPAATAATPGGPLEPAAAPSPGEGSQAGAGGGTAAAAASGG
ARRFLCGVVEGFYGRPWVMEQRKELFRRLQKWELNTYLYAPKDDYKHRMFWREMYSVEEA
EQLMTLISAAQEYEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDI
DHNMCAADKEVFSSFAHAQVSITNEIYQYLGEPETFLFCPTEYCGTFCYPNVSQSPYLRT
VGEKLLPGIDVLWTGPKVVSKDIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPY
KGRSTELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMTDSEDSTVSIQ
IKLENEGSDEDIETDVLYSPQMALKLALTEWLQEFGVPHQYSSRQVAHSGAKASVVDGAP
LVAAPSLSATTVVTTVYQEPIMSQGTTLSNEPPALVKEEEKKQMDEEPMDMVVEKQEETD
KNDNQILTEIVEAKMAEELKPMDTDKESIAESKSPEMSMQEDCISDVAPMQTDEQTNKEQ
FVPGPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCK
GKDSEKIEEWRSRAAKFEEMCGLVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSF
VQWLGCRSQSSAQFLIGDQEPWAFRGGLAGEFQRLLPIDGANDLFFQPPPLTPTSKVYTI
RPYFPKDEASVYKICREMYDDGVGLPFQSQPDLIGDKLVGGLLSLSLDYCFVLEDEDGIC
GYALGTVDVTPFIKKCKISWIPFMQEKYTKPNGDKELSEAEKIMLSFHEEQEVLPETFLA
NFPSLIKMDIHKKVTDPSVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCF
EIAKMEGFPKDVVILGRSL
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagaaggagaaccaggcggcactggaggagcgggagagcgagctcacccccaac
cctgctgctaccgctgccacccccgggggtcccctggagccggctgcagccccatccccg
ggggagggcagccaggctggggcaggaggcggaactgccgccgccgctgcctcgggtgga
gcacggaggttcctctgtggtgtggtggaaggattttatggaagaccttgggttatggaa
cagagaaaagaactcttcagaaggctacagaaatgggaattaaatacatatttgtatgca
ccaaaagatgactacaagcataggatgttttggagagaaatgtattcagtggaagaagct
gagcaactcatgacactcatttctgctgcacaagagtatgagatagaattcatctatgcc
atctcacctggactagacatcaccttttctaatcctaaagaagtgtccacattaaaaaga
aaactggatcaggtttcccagtttggttgcagatcctttgccttgctttttgatgatatt
gatcacaacatgtgtgcagcggacaaagaagtgttcagttcttttgctcatgcccaggtc
tctataacaaatgaaatttatcagtatttaggggagccagaaacctttcttttctgcccc
acagaatattgtggaactttttgctatccaaatgtttctcagtctccttatttaaggact
gtgggtgaaaagctcttacctggtattgatgtgttgtggactggtccgaaagttgtttct
aaagacattccagtagagtctattgaagaggtttccaagattattaaaagagctccagtt
atttgggataacattcatgctaatgattatgaccagaagagactatttcttggcccatac
aaaggtcgatcaacagagctcattccacgcctaaaaggagtcctgactaatccaaactgt
gaatttgaagctaactatgttgctattcatactctggccacctggtacaaatcaaatatg
aatggagtgaggaaagatgtagtaatgaccgatagtgaagacagtacagtatctattcaa
atcaaattagaaaatgaaggcagtgatgaagatattgaaactgatgtactgtatagtcct
cagatggccttgaagttggctttaacagaatggctgcaggagtttggtgtacctcatcaa
tatagcagtagacaggtggcacacagtggagcaaaagcaagtgtagttgatggggccccc
ctggtggcagcaccctccctaagtgccaccacagtagtaacaaccgtttaccaggaacct
atcatgagccaaggaacaactctaagcaatgaacctccagccctcgtcaaggaagaagaa
aagaaacagatggatgaggaacctatggatatggtggtagagaaacaagaggaaacggat
aagaatgataatcagatacttaccgaaattgtggaagctaaaatggctgaagagttgaaa
ccaatggatactgacaaagaaagcatagctgaatcaaagtctccagagatgtcaatgcaa
gaagattgcattagtgatgttgccccaatgcagactgatgaacagacaaacaaggagcaa
tttgtaccaggtccaaatgagaaacctttgtatacagcagaaccggtgactttggaggat
ttacagttacttgctgatcttttctatcttccatatgagcatggtcccaaaggggcacag
atgttaagagaattccagtggcttcgtgcaaatagcagtgttgtcagtgttaattgcaaa
ggaaaagattctgaaaagattgaagaatggagatctcgagcagccaaatttgaagagatg
tgtggactggtgatggggatgttcactcgactctccaattgtgccaacaggacaatcctt
tatgacatgtactcctatgtttgggatatcaagagtataatgtctatggtgaagtctttt
gtgcaatggttagggtgtcgtagtcaatcttcagcacagttcttaattggagaccaagaa
ccctgggcctttagaggtggtctagcaggagagttccagcgattgttgccaattgatggg
gcaaatgatctcttttttcaaccacctccactgactcctacctccaaagtttatactatc
aggccatactttcctaaagatgaggcatctgtgtacaagatttgcagagaaatgtatgac
gatggagttggtttaccttttcaaagtcaaccagaccttattggagataagttagtggga
ggcctgctttccctcagtttagattactgttttgtgctagaagatgaagatggcatttgt
ggttatgccctgggcactgtggatgtaaccccttttattaaaaagtgtaaaatttcctgg
attccgttcatgcaagaaaagtacactaagccaaatggtgacaaagagctctctgaggct
gagaaaataatgttgagtttccatgaagagcaggaagtattgccagaaactttccttgcc
aatttcccatctctgataaagatggacattcacaaaaaagtaacggatccaagtgtggcc
aaaagcatgatggcttgcttgctgtcttccctcaaagctaatggctcccgtggggcattc
tgtgaagtaagaccagatgataagaggatcctggaattctacagcaagttaggttgtttt
gaaatagcaaagatggagggatttccaaaggatgtggttatccttggcaggagcctgtga

DBGET integrated database retrieval system