KEGG   Monodelphis domestica (opossum): 100023487Help
Entry
100023487         CDS       T01031                                 

Gene name
PLCE1
Definition
phospholipase C, epsilon 1
Orthology
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Proteoglycans in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100023487 (PLCE1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100023487 (PLCE1)
   04015 Rap1 signaling pathway
    100023487 (PLCE1)
   04020 Calcium signaling pathway
    100023487 (PLCE1)
   04070 Phosphatidylinositol signaling system
    100023487 (PLCE1)
   04024 cAMP signaling pathway
    100023487 (PLCE1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100023487 (PLCE1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100023487 (PLCE1)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100023487 (PLCE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1821 aa AA seqDB search
MPGPFYKIEVPGRIHQSESPQRTFQERQPCTSVAGSMNLPSSVAGLSNELIELQHLIQFP
EEVACILTEQEQSIYRQVLPVDYLCFLTRALGNEECQRQLPCLKASVSASLLTSPNGEHN
ALEDLVTRFNEVSSWVTWLILTAGTMEEKREVFSYLVHIAKCCWNMGNYNAVMEFLAGLR
SRKVLKMWQFMDQSDIETMRSLKDAMAQHESSSEYRKVVNRALNIPGCKVVPFCGVFLKE
LCEILDGTSGFMKLCPRYNSQDETLEFVADYNGQDNFLQRVGQNGLNNPEKESTVNSIFQ
IIRSCNRSLEPEEEDNFSEGDNSRKNSLKDKTRLQFSIGELSDSENDHFEPAKEWDFRAA
EEEQKAFHHGTELIPWYVLSIRADVHQFLLQGATVIHYDQDTHLSARCFLRLQPDNSTLS
WAKPTTASAAVTKAKLSVSGIPAEPGRLPSPGNTGLNGLVEGFLDLFSAKAVYMGHPGID
MHAVCVQNKLSNMSVSENSVTLLYGLQTTDNRLLHFVAPKHTAKMVYEGLLELTKAVRKM
RKFPDQRQQWLRKQYVSLYQEDGRFEGPTLAHAIELFGGRRWTTRNTSPSTLSKSAEKPT
VQRNNTLGISANKKKKKILLRGESGEVTDDETAAWKAKMYKECRGRSGSDPQDLNEQEEA
DPNGPSPATNPPSRRARSLTPAGCAAALPAPVRPLSSPILSPSNRSQPNTWSSSSWHGRV
KGGLKGFQNFMVSDSSMSFVEFVELFKSFSVRSRKDLKDLFDVYAVPCSRSGSDSIPLYT
NLRIDENTSGLQPDLDLLTRNVSDLGLFIKTRQQLSDNQRQISDAIAAASIVTNGSGIES
TRLGVCGVGILQLNDFLVNCQGEHYTYDDILSIIQKFEPSVSMCQQGLMSFEGFSRFLLD
KDNFASQNDESQENVKELQFPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSV
ELDCWDGDDGMPIIYHGHTLTTKIPFKEVVEAIDRSAFINSDLPIIISIENHCSLPQQRK
MAEIFKNVFGEKLVAKFLFESDFSDDPMLPSPDQLRRKVLLKNKKLKAHQTPVDILKQKA
HQLASMQTQTSNGSNANPTPANEEEEDEEDEYDYDYESLSDDNILEDRPESKSAGDKLQF
EYNEEITKRIKKTESSVGNKGKVYDMELGEEFYLPQNKKESRQIAPELSDLVIYCQAVKF
PGLSTLNPSGSSRGKERKSRKSIFGNNPGRLSPGETAAYAKTSGKSAGDGMRQPWEEAGA
LNSPPSLSALIRTPKCYHISSLNENAAKRLCRRYSQKLIRHTACQLLRTYPAATRIDSSN
PSPLLFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPILWDKNCALYQQFSP
LERDLESVAPALYSLTIVSGQNVCPGNSTGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNP
MWNEQFLFRAYLEDLLFLRFAVVENNSSAVTAQRIIPLKALKRGYRHLQLRNLHNEVLEI
SSLFLNSRRMEENSSGGVAASLMFSTEERKSLETHKVTVHGIPGPEPFAVFTINEETKAK
QLLHQILTTSQGSTPIITDCFLMEEKYFISKEKNDFRKQPFQRIISPEEEIVQILNSWFP
EEGYVGRIIFKIQEEPTEEKSVFQEEKEVALSSEEESFFVQVHEISPEQPSTVIKAPRVS
TAQEVIQQTLCKAKYSYSILSNPNPSDYVLLEEVLKEPPNKKSSTAKSSQRILGDQECVF
QAQSRWKGAGKFILKLKEHVQAARDDKRKGISFANELKKFTKSSKQLRGFTSPSQLSVPE
SIQMKEEKPVGSFSSNDMMDP
NT seq 5466 nt NT seq  +upstreamnt  +downstreamnt
atgcctggacctttctacaaaatagaagttccaggaagaattcaccaaagtgagtcccca
cagagaacatttcaggaacgtcaaccatgcacctccgtggctggttcaatgaacctccct
tccagtgtggctggtctcagtaacgagctcatagaacttcaacacctcattcagttcccc
gaggaagttgcttgtattctgactgaacaggagcagagcatctaccgacaagtcttacct
gtggattacctttgcttcttaaccagggccttgggaaatgaagaatgccagaggcaactt
ccctgcctcaaggcatcagtgtcggcctctctcctgacctccccaaatggcgagcacaat
gctctggaggatcttgtaacaaggtttaatgaggtgagctcttgggtgacatggctgata
ctcacagcaggcaccatggaagaaaaacgagaagtcttctcatatttagtacacattgca
aaatgctgctggaatatgggcaactataatgctgttatggaattcttggctggtctcagg
tcaaggaaagtcttaaagatgtggcagttcatggaccagtctgacattgaaaccatgaga
agtctgaaggatgccatggctcaacatgaatcttcctctgaatataggaaagtggtgaac
cgggctctgaatatccctggctgtaaagtagttcctttttgtggtgtgtttttaaaggaa
ctttgtgaaattctagatggaacatctggatttatgaaactttgtccacgttataactca
caagatgagactttagagtttgtagctgattacaatggacaagataatttcttacaacga
gtagggcaaaatggcttaaacaatccagagaaggagtccactgtcaacagcatttttcaa
attatccgaagctgcaatcgaagtctggaacctgaagaagaagataattttagtgaaggc
gacaattcaaggaaaaactccttaaaggataaaactcgattacaattctcgatcggagag
ctgtctgattcagaaaacgatcattttgagccggcgaaagaatgggatttccgtgcagca
gaagaagagcagaaagctttccaccacggaacagaactgattccctggtatgtgttgtct
atcagggccgacgtccatcagttcctcctccaaggagccaccgtcattcactatgaccag
gacacacatctctcagcacgctgttttcttcggctgcagccggataatagtaccttatcc
tgggccaaaccgacgactgcctcggcggctgtgacgaaagccaagctgagcgtctccgga
atcccagcggagcctggcagacttccgtcgcccggcaatactggattaaatggattggtg
gaagggttcttggatttgttttcagccaaggccgtgtacatgggacatcctggcatcgat
atgcacgcggtgtgtgttcaaaacaaactcagtaacatgtccgtgtccgagaacagcgtg
acgctgctttatgggctccagacgaccgataatagattattacactttgtggccccgaaa
cacaccgccaagatggtatatgagggcttgttggaattaacaaaagctgttcgaaaaatg
aggaaatttcccgaccagcgacagcagtggctgaggaagcaatatgtcagcctctatcag
gaggacgggagattcgaaggtccgacgttagctcacgcgattgagctctttggtggcaga
cgctggacgacgcgaaacacgagcccttcgacgctctccaaaagtgccgagaagcccacc
gtccagaggaacaacaccctcgggataagcgcaaataagaaaaagaagaaaatcctgctg
aggggggaaagtggagaggtgaccgatgatgagacggccgcatggaaggcaaaaatgtat
aaggagtgtcgtggccgcagtggttcagatccccaagaccttaacgagcaagaagaagca
gatccaaacggtcctagtcctgccaccaatccgccctccagaagagctcgctccttgact
ccggccggctgtgccgccgccctgcccgcccccgtcagaccgctctcctctcccatcctg
tcgccttccaacaggagtcagcccaatacatggagcagcagtagttggcatggccgagtg
aaaggtggactgaaaggatttcaaaatttcatggtttcggatagtagcatgagttttgtt
gaatttgtagagctcttcaaatcgttcagtgtacgaagtcggaaggacctcaaggatctg
tttgatgtttacgctgtgccctgtagtcgatcaggctctgattctatcccgctctataca
aacctgagaattgatgaaaataccagcggccttcagcctgacttggatttgttaaccaga
aacgtgtccgatttgggcttgttcattaagaccaggcaacagctctcagacaaccagagg
cagatctcggacgccatcgcggctgcgagcatcgtgaccaacggctctggaatagaaagc
accaggctcggggtctgtggagttggcatactgcagctgaatgactttttagtgaattgc
caaggcgagcactacacttacgacgacatactcagcattattcagaagttcgagcctagc
gtgagtatgtgtcagcaaggtctaatgtcgtttgaaggattttccaggtttctgttggat
aaagataattttgcatcacaaaatgacgaatcacaggagaatgttaaagaattacagttc
cccctctcctattattacattgaatcttcacacaatacatacctcacaggacatcagctt
aaaggggaatcgtcagtggagctatatagccaggttctcttgcaaggctgtcgaagtgta
gaactagactgctgggatggtgatgatgggatgcctattatttatcacggacatacactc
actactaagattcccttcaaggaagtcgttgaagccattgatcgcagtgccttcatcaac
tccgatttgcccatcataatatctatagaaaatcactgttccttgcctcagcaacgaaaa
atggcagaaattttcaagaatgtatttggagaaaaactggtggccaagtttttattcgag
agtgatttctctgatgatccgatgcttccttcacctgaccaacttaggagaaaagtgctt
cttaaaaacaaaaagctaaaagcgcatcagactccagtggatatattaaagcaaaaggct
catcagttggcatccatgcagacacagaccagcaatggcagtaatgccaatcctacccca
gctaatgaggaagaagaagatgaggaagatgaatatgattatgactatgaatctctttct
gatgacaatattctggaagacagacctgaaagtaaatcagcaggtgacaaactacagttt
gagtacaatgaagaaattaccaagaggataaagaaaacagagagctctgttggcaacaaa
ggaaaggtgtatgacatggaacttggtgaagaattttatctcccacagaataaaaaagaa
agtagacaaatagccccagagctttctgacctcgtcatctactgccaagctgtaaaattt
ccaggactgtcaactttaaacccatctggctctagcagaggaaaagaaaggaaaagcagg
aagtccatttttggcaacaatccgggcagattaagccctggggagacagctgcatatgcc
aaaacatctggaaaaagtgccggggacggcatgcggcagccctgggaagaagcgggggcg
ctcaacagcccgccgtccctcagcgcgctcattcggaccccgaagtgttaccacatctcc
tccctgaacgagaacgcagccaagcgcctgtgccgccgctactcccagaagctgatccgg
cacaccgcctgccagctactccgcacctacccggccgccacgcgcatcgactcttccaac
cccagcccgctcctgttctggctgcacggcatccagctggtggcgctcaactaccaaacc
gacgatctccccttacatttaaacgcggccatgtttgaggcgaatggtggatgtggttat
gtcctgaagccccccatcctgtgggacaagaactgtgctctgtaccagcagttttctccg
ttggaaagagatctggaaagcgtggcacctgcgctctattctttaactatcgtctccggt
cagaacgtctgtcctggaaacagcacgggcagtccgtgcattgaagtcgacgtcctggga
atgccgctggatagctgccacttccgcacgaaacccattcatcggaatactctgaatccc
atgtggaatgagcagtttctcttccgagcttatttggaagatctcctgtttcttcgcttt
gcagttgttgaaaacaacagttcagctgtaacggctcaaagaatcattccgctaaaggct
ttaaaaagaggatatcggcatcttcagctgagaaacctgcataacgaagtcttggaaatc
tccagcttgttcctcaacagcaggaggatggaggagaactcgagcggcggcgtggcggca
tctctgatgttcagcacggaagagagaaaaagtctggagacgcacaaggtcacagtccat
gggattccaggccctgagccttttgctgttttcacaataaatgaagagactaaagcaaag
caacttcttcaccaaattttgactacttctcaaggctccacaccaatcatcacagactgc
tttttgatggaagaaaaatattttatatccaaagaaaaaaatgacttcaggaaacagcca
tttcagagaataatcagtccagaagaagaaattgtacagattttgaacagctggttccca
gaagaaggttatgttggaaggattatttttaaaatccaggaggaacccactgaagagaag
agcgtcttccaggaggagaaggaggtggccctgagctcagaagaggagagcttcttcgtg
caagtccacgagatctccccggagcagcccagcaccgtcatcaaagctcctcgggtcagc
actgcccaggaggtcatccagcagaccttgtgcaaagccaagtactcttacagtattctg
agcaaccccaaccccagcgactacgtgcttctggaggaggtgctcaaggagccacccaac
aagaagtcctctacagccaagtcttcccagaggatcctcggcgaccaggaatgtgtgttc
caggcccagagcaggtggaagggcgctgggaagtttattctgaagctaaaggagcatgtg
caggcagctcgagatgataaaagaaaaggcatttcttttgctaatgaacttaagaaattc
accaagtcaagtaagcaacttcgaggattcacatcaccttctcagctttcagtaccagaa
agtatccagatgaaggaagaaaaacctgtgggcagcttctcttctaatgacatgatggac
ccataa

DBGET integrated database retrieval system