KEGG   Monodelphis domestica (opossum): 100023492Help
Entry
100023492         CDS       T01031                                 

Gene name
PFKL
Definition
phosphofructokinase, liver
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
AMPK signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100023492 (PFKL)
   01230 Biosynthesis of amino acids
    100023492 (PFKL)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100023492 (PFKL)
   00030 Pentose phosphate pathway
    100023492 (PFKL)
   00051 Fructose and mannose metabolism
    100023492 (PFKL)
   00052 Galactose metabolism
    100023492 (PFKL)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100023492 (PFKL)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100023492 (PFKL)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100023492 (PFKL)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100023492 (PFKL)
Protein phosphatases and associated proteins [BR:mdo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100023492 (PFKL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 693 aa AA seqDB search
MASHTTAALGGLEQLRMCGAGAGRALAVLTSGGDAQGRHIFRAECGGLLQQLVEEGKIPE
SVAQTYSHLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEVIDAITTTAQSHQRTFVLEV
MGRHCGYLALVSALASGADWLFIPESPPEDGWENFMCERLGETRSRGSRLNIIIIAEGAI
DRHGKPITSTYVKDLVVQRLGFDTRVTVLGHVQRGGTPSAFDRVLSSKMGMEAVMALLEA
TPDTPACVVSLSGNQNVRLPLMECVQVTKDVQKAMDEKRFDEAIQLRGRSFETNWNIYKM
LAHQKVSQEKSNFSVAILNVGAPAAGMNAAVRSAVRTGISQGHKVYIIHDGFEGLAKGQI
HEVNWHDVAGWLGRGGSMLGTKRTLPKTCLEKIVENVRAYNIQALLVIGGFEAYEGVLQL
VEARSQYEELCFVMCVIPATISNNVPGTDFSLGSDTAVNAAMESCDRIKQSASGTKRRVF
IVETMGGYCGYLSTVTGIAVGADAAYVFEDPFTIHDLKANVEHLTDKMKTDIQRGLVLRN
EKSHEHYTTEFLYNLYSSEGRGIFDCRTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWMS
DKLRQSYRKGRVFANSADSACVIGLRKKTVAFSPVTELQKVTDFEHRMPQEQWWLDLRLM
LKMLANYQISLTEYVPGKMEHVTRRTLSIEKGF
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccacacgaccgcggccctgggcggcctggagcagctgcgaatgtgcggggca
ggagcaggccgcgccctggccgtgctcacgagcggcggggacgcccaagggcgccacatc
ttccgcgccgagtgtggcggcctcctgcagcagctggtggaggaagggaagatccccgag
tccgtggcccagacctactcgcacctcaacatcgtggggctggtgggctccatcgacaac
gacttctgtgggacggacatgaccatcggcaccgactcggccctccatcgcatcatggag
gtcatcgatgccatcaccaccacggcccagagccaccagaggacgttcgtgctggaggtg
atgggtcggcactgcgggtatctggccttggtgtctgccttggcgtctggcgccgactgg
ctcttcatccctgaatccccccctgaggatggctgggagaacttcatgtgtgagagactt
ggggagacacgaagcaggggctccaggctcaacatcatcatcattgcagaaggtgccatc
gaccggcacgggaagcccatcacgtccacttacgtgaaggatctggtggtccagcgcctg
ggctttgacactcgagtgactgtcctgggccatgtgcagcggggagggacgccttctgcg
tttgacagagtcctgagcagcaagatgggcatggaggctgtgatggccctgttggaggcc
acgccggacacccccgcctgcgtggtgagcctttctgggaaccagaatgtgcgcctgcca
ctgatggagtgtgtccaggtgacgaaggacgtgcagaaagccatggatgaaaagcggttc
gatgaggccatccagcttcgggggaggagttttgaaaccaactggaacatctacaagatg
ctagcccatcagaaagtctcccaggagaagagtaacttctccgtggccattctgaacgtg
ggggctccagctgcaggcatgaacgctgctgtaaggtccgcagtgcggaccggcatatcc
cagggacacaaagtctacatcattcacgatggcttcgagggtctggccaaggggcagata
cacgaggtgaattggcacgatgtggctggctggctggggcgaggaggatccatgctgggg
accaagaggactctgcccaaaacttgcctggagaaaattgtggaaaacgtgcgagcttac
aacatccaggccctgctggtcatcggaggctttgaggcctacgaaggtgtgctgcagctg
gtggaggcccgcagccagtacgaggagctctgcttcgtcatgtgcgtcattcccgccacc
atcagcaacaacgtccccggcaccgacttcagcctgggctcggacacagctgtcaacgcc
gccatggagagctgtgaccgcatcaagcagtcggcttccggcaccaagaggcgggtgttc
atcgtggagacgatgggaggctactgtggctacctgtccacggtgacgggcatcgcggtg
ggcgcggacgctgcctacgtgtttgaagaccccttcaccatccacgacctgaaggccaac
gtggaacatctgacggataagatgaagaccgacatccagcgggggctggtgctccggaac
gagaagagccacgagcactacaccacggagttcctgtacaacctgtactcctccgaaggg
agaggaatattcgactgccggacgaacgtcctgggacacctgcagcagggaggagccccg
acccccttcgaccggaactatggcaccaaactcggggtgaaggccatgctctggatgtcc
gataagctgcggcagtcctaccgaaaggggcgcgtttttgccaactctgcagactccgcc
tgtgtcattgggctgaggaagaagacggtggccttcagccccgtcaccgaactccagaag
gtcacggattttgagcaccgcatgccccaggagcagtggtggctggacctgcggctcatg
ctcaagatgttggccaactaccagatcagcctgaccgagtatgtgccagggaagatggag
cacgtgacccggcgcaccctgagcatcgagaagggcttctga

DBGET integrated database retrieval system