KEGG   Monodelphis domestica (opossum): 100023529Help
Entry
100023529         CDS       T01031                                 

Definition
cytochrome P450 4Z1-like
Orthology
K07428  
cytochrome P450, family 4, subfamily X [EC:1.14.14.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100023529
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100023529
Cytochrome P450 [BR:mdo00199]
 Cytochrome P450, animal type
  CYP4 family
   100023529
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 511 aa AA seqDB search
MGADKIPSWLETHWTRPLHLALTFVLALLLLQVVKLYLRRQGLLRALRLFPGPPPHWLFG
NQREFYLEKELQQFNVLPEQYPCALPLWVGAFQVLLNIYDPEYAKILLNRRDPKIQHGYK
FIIPWIGGGLLSLEGKKWYQHRHLLTPAFHLSILKPYIHVMNDSVCRMLDTWEKLSTQDN
SVEICEPIRLMTLDSIMKCAFSVQTSSQTESFSTNYLSTVTKLSELIFCRLNNYLHHNDL
IYRWSSQGQEFQALCQIAHQLPAKIIQERREALKNNSEQDKIRKKKFLDFLDVLLCAKSE
NGEGLSNEELEAEVNTFVFGGHDTTASSLSWIFYCMAMNPEHQHQCREEIRNIIKYGDTI
TWDHLDQMPYSTMCIKEALRLYPPSITIARELSKPITFPDGRFLPTGMTVVLNIWALHHN
PTVWENPQVFNPERFSQENSMKRHSYAFLPFSAGPRNCIGQQLAMLELKVGLALTLLRFE
LLPDLEKPPIPMPHLVLRSKNGIHLYLRPLH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcggataagatcccttcttggctggagacgcactggactcggcccttgcacttg
gccttgacgttcgttctcgcgctgctgctgttgcaggtcgtcaagctctacctccggcgc
cagggactgttgcgagccctgcgcctcttccccggaccccctccacactggctctttggg
aaccagagagagttttacctggaaaaagaactccagcaatttaatgtgttgccagaacaa
tacccttgtgctctccctctctgggttggggcctttcaggtgcttttaaatatctatgac
ccagaatatgcgaaaattcttctgaaccgaagagatcccaaaatacagcatgggtacaag
tttattatcccctggattggaggaggactgctgagcctggaaggaaagaagtggtaccag
catcgccatctgctgactcctgccttccacttgagcattctgaagccctacatccatgtg
atgaatgattcagtctgcaggatgctggatacatgggagaagctcagcacccaggacaat
tctgtggagatctgtgagcccattcgcctgatgaccttggacagcatcatgaaatgtgcc
ttcagtgtccagaccagctcccaaacagaaagcttttctaccaactacctctcaactgtg
acaaaactctcagaactaatcttctgccgcctgaacaactacctccatcacaatgacttg
atttacaggtggagttctcaggggcaagaattccaagctctctgccaaatagcacatcag
ctcccagctaagatcatccaggaaaggagggaagcactcaagaataatagtgaacaggac
aagatccgaaaaaagaagttcttggattttctagatgttcttctttgtgccaaaagtgaa
aatggagaaggcttatcaaatgaagagctagaggctgaggttaacacatttgtgtttggt
ggtcatgacactacagcctctagtctttcctggatcttctactgtatggccatgaaccca
gagcaccaacaccaatgtcgagaagagatcagaaatatcataaaatatggggataccatt
acctgggaccacctagaccagatgccctacagcaccatgtgcatcaaggaggccctccgc
ctctacccacctagcatcactatagccagagaacttagcaaacccatcacctttccagat
ggacgcttcttgcccacaggcatgacagttgtcctgaatatctgggctctccaccacaac
cctactgtctgggaaaacccacaggtctttaaccctgaaaggttctcccaagagaattcc
atgaagagacactcctatgctttcttacccttctcagctggacctaggaactgcattgga
caacagcttgccatgttggaactgaaggtgggactggccctgaccctgctccgttttgag
ctattaccagatctggagaagcctcctattccaatgccccacttggttctcaggtctaag
aatgggattcatctatacctaaggccactgcactag

DBGET integrated database retrieval system