KEGG   Monodelphis domestica (opossum): 100023556Help
Entry
100023556         CDS       T01031                                 

Gene name
USP10
Definition
ubiquitin specific peptidase 10
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100023556 (USP10)
Peptidases [BR:mdo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100023556 (USP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 832 aa AA seqDB search
MALRGPQYVFGDFTPDEFNQFFVTPRSSVELPPYNETILCDTETPEELHDVLSVTGTSIS
VHATLHPRNITEWVETKMRGSKVDCQLIGEEYQRIEFGVTEVIEQDESLLNNTDYSISST
LNPQAPEFILGCTTSKKNHDDIHNETNYNSIDCQFTSPVLALDNGSNAEAENIENDSLSG
SLGQRERKKKKKRPPGYYSYLKDGSDHIPTEALVNGHANSSVLNNISTEDTEFMRNIPSS
ARPRTCNSPENSVDFISDTVTDDSFPRALDNTRTAGQPEVCHVTNFEQSCIPSEAGRGSP
LRTAVAQPYSGTTENLGVANGQTLESSVEGPAANGVELYTVESTDSDPAKHDNASPTAEV
TTPVTGSVSVNQPAKSWASLFHNSKPSASTPVAYVETKYSPPATSALVPEKQVEVKEGLV
PVSEDPVAIKIAELLENVTLIHKPVSLQPRGLINKGNWCYINATLQALVACPPMYHLMKF
IPVYSKVQRPCTSTPMIDSFVRLMNEFTNMPIPPKAKQALGDKIVRDIRPGAAFEPTYIY
RLLTVIKSSLSEKGRQEDAEEYLGFILNGLHEEMLNLKKLLLPNNEKFSVSNGPDAQSVH
EDEQGQGEGSEDEWEQVGPRNKTSVTRQADFIQTPITGIFGGHIRSVVYQQSSKESATLQ
PFFTLQLDIQSDKIHTVQDALESLVARESVQGYTTKTKQEVEISRRVTLEKLPPVLVLHL
KRFVYEKTGGCQKLIKNIEYPVDLEISRELLSPGVKNKNFKGHRNYRLFAVVYHHGNSAT
GGHYTTDVFQIGLNGWLRIDDQAVKVINQYQVVKPSAERTAYLLYYRRVDLL
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atggccctccgcggcccccagtatgtttttggagattttactcctgatgagttcaatcag
ttttttgtgactcctcgttcttctgttgagcttccaccatataatgaaacaattttgtgt
gacactgaaaccccagaggaactgcatgatgttctcagtgtcacaggtacttccatttca
gtccatgcaacattgcatcctcgaaacatcacggaatgggttgaaacaaagatgcgtgga
agcaaagtggactgtcaacttataggagaagagtatcaacgaattgagtttggtgttact
gaagttattgaacaagatgaatctttactgaataacactgactacagtatttcaagcaca
ctgaatcctcaggccccggaatttattcttggttgcacaacttccaaaaagaaccatgat
gacatacacaatgaaaccaactacaactccatcgactgtcagttcacaagccctgtgctt
gctttggataatggttctaatgccgaagctgaaaatatagaaaatgacagcctttctggc
agccttggacaaagggaacgtaaaaagaagaaaaaaaggccacctggatactacagttat
ttgaaagatggcagtgatcatatccctacagaagcccttgtaaatggtcatgcaaattca
tcagtactgaacaatataagcacagaggatacagaatttatgagaaatataccatcatca
gctaggccaaggacttgtaatagccctgaaaattctgtggacttcatcagtgacactgtg
actgatgattcttttcctagagcactagacaataccaggactgcagggcagcctgaggta
tgccatgttactaattttgaacagtcttgcatcccttcagaggctggcaggggtagccca
ttaaggacagctgttgcacagccttattctggtactactgaaaatcttggagttgctaat
ggacaaacacttgaatcctctgttgagggcccagctgccaatggggtagaattgtacact
gtggaaagcactgactcagatccagctaagcatgacaatgcttcacctactgctgaagtc
acaacccctgttacaggatcagtttctgttaatcaacctgctaaatcttgggctagcctt
tttcacaattctaagccctccgcttccacacctgtggcttatgttgaaactaaatattcc
cctcctgccacatctgctctggtccctgaaaaacaggttgaagtcaaagaagggcttgtt
ccagtttcagaggatcctgtagccataaagattgcagaattactagaaaatgtaacgcta
atacacaaaccagtatctttgcaaccccgggggctgatcaataaaggaaactggtgctac
atcaatgctacactgcaggcattggttgcttgccccccaatgtatcacctcatgaagttc
attccagtgtattcaaaagtgcagcggccatgcacatcaacacccatgatagacagtttt
gttcgactaatgaatgagttcaccaatatgccaatacctccaaaagccaaacaagctctt
ggtgacaagatagtgagggatatccgccctggagctgcctttgaacctacttatatatat
agactactgacagttatcaagtcaagcctctctgagaagggtcgacaggaagatgctgaa
gaatatctaggatttattctaaatggactacatgaggaaatgctgaacttaaagaaactt
cttttaccaaataatgaaaaattttcagtttccaatggacctgatgcacagtctgtacat
gaagatgaacagggacaaggagaaggtagtgaggatgaatgggaacaggttggtccccgg
aacaaaacttcagtcactcggcaagctgactttattcagactccaattactggcatcttt
gggggacacataagatctgtagtttaccagcagagttcaaaggaatctgccactttgcag
ccattttttaccttgcagttggatatccagtctgacaagatacacacagtccaggatgca
ttggaaagtctggtagcaagagaatctgtccaaggatataccacaaaaaccaagcaagag
gttgagattagtcggagagtgaccctggaaaagctcccccccgttcttgttctgcacctc
aaacggtttgtgtatgaaaagactggtggatgtcaaaagcttatcaagaatatcgagtat
cctgtggacttggagattagcagagagctgctttctccaggtgtaaaaaacaaaaatttt
aaaggccacagaaactatcgtctttttgcagtggtctatcatcacggaaacagtgcaact
ggtggtcattatactacagacgtcttccagattggtctgaatggctggttacgtattgat
gaccaggcagttaaagtgattaaccagtaccaggtggtgaagccttctgctgaacgcaca
gcctacctcctgtactatcgccgagttgacctgctctaa

DBGET integrated database retrieval system