KEGG   Monodelphis domestica (opossum): 100023604Help
Entry
100023604         CDS       T01031                                 

Gene name
PRF1
Definition
(RefSeq) perforin 1
  KO
K07818  
perforin 1
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Apoptosis
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100023604 (PRF1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100023604 (PRF1)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    100023604 (PRF1)
   05330 Allograft rejection
    100023604 (PRF1)
   05332 Graft-versus-host disease
    100023604 (PRF1)
  Cardiovascular diseases
   05416 Viral myocarditis
    100023604 (PRF1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100023604 (PRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 559 aa AA seqDB search
MVWSSSSSLLFLLLILLQLLQPTPAPCHTATRAECHRQEIFVPGWGLAGEGIDITTLHRT
GYFPVDTHRFKRPDGTCTLCRNDLQEGQLQRLPLAITDWRSQSPKCQRNVVKTEASSVVE
VAAQASKRIKNDWKVGLDVQPNPKVNVHMSMSGSHSKEAQFAAEKKQQDEYSFKGELVQC
HNYRFHLVEKPPLTRAFIQAVRALPRQFNASTRVHYFRLIKNYGTHFLKSLELGGKVTDV
TALRTCKLSLDGLKADEVSSCLKVEAAVTVGTAVSTADVENCMEKKKNHHIQGSFHTTYN
ERHVDVEGGILSGGSIDLLFSDQNGAEKFTEWMNTLSSNPGLLAYTLDPLHFLLGSKNPQ
RVELRKAVSDYILSRARWQNCNKPCPPGQKKSPQNPCHCVCQASTLTNGDCCPRERGLAH
LEVTGLSARNLYGDIFSLTDGYIKAFFGNKELRTYVVWNNNNPKWDQNLDFGAVSLMAGG
PLRLQVWDADHGWDDDLLGSCDRVPVAGGRKEQCHLNHGFLTFHYQVTCAPYLKGHKCLE
YAPHRALGEPVGNRSGAVW
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggtatggtcctcctcctcttccctcctcttcctcctgctcatccttctccagctgctc
cagcctacaccagccccctgccacacggccacccgtgctgagtgccaccgccaagagata
tttgtacccggctggggtttggcaggggaaggtatagatatcaccaccctgcaccgaact
ggctacttccccgtggatacccatagattcaagcgtcctgatggcacctgcaccctatgc
cgaaatgatctgcaggagggtcagctccagcgccttcccttggctatcacagactggcgc
agccagagtcctaagtgtcagcggaatgtagtcaagactgaggcttcctctgtcgtggaa
gtggctgcccaggcctccaagagaatcaagaatgactggaaggtgggcctggacgtccag
cccaatcccaaagtcaatgtacatatgtccatgtcgggctcccactccaaagaagcccaa
ttcgcagctgaaaaaaaacagcaggatgagtacagtttcaagggtgagttggttcagtgt
cataactacagatttcacctggtagagaagcccccgctgactcgagcgttcattcaggct
gtcagggcactgcctcgccaatttaatgcctccactcgagtccactattttaggctcatc
aagaattatggcacccactttctcaagtccttggagctgggggggaaggtcacggatgtc
acggcccttcgcacatgcaagctgtctctggatgggctcaaggccgacgaggtgagctcc
tgcctcaaagtagaggcagccgttactgtggggactgctgttagcacagcggatgttgag
aactgcatggagaagaagaagaaccaccacatccagggttccttccataccacctacaat
gagcgccatgtggacgtagagggaggtattttgagtgggggctcaatcgacctgctcttc
tcagatcagaatggggccgagaagttcacagaatggatgaacaccctctccagtaacccc
ggccttttggcctatactctggaccccctgcacttcctcctgggatctaagaatccccaa
cgggtggagttaagaaaggctgtgagtgactacatactcagcagagcccggtggcagaac
tgtaataagccatgccctccagggcaaaagaaaagcccacaaaacccctgccactgcgta
tgccaggcatccaccctcaccaatggcgactgctgcccccgggagagagggctggcccat
cttgaagtgactggcttgagtgccaggaacctatacggagacatcttctccttaactgat
ggctacataaaggccttcttcggtaacaaggaactgaggacctatgtggtgtggaacaac
aacaatcccaaatgggaccagaatctggacttcggggccgtgtcgctgatggctggggga
cccttgaggcttcaggtatgggatgcagaccacggttgggacgatgaccttctgggctct
tgtgaccgtgtgccggtggcaggaggacggaaggagcaatgtcatttaaatcatggcttc
ctaacattccactaccaagtgacatgcgccccatatctcaagggccacaaatgtctagag
tatgcccctcatagagctcttggggagccagtgggaaaccggagtggagccgtgtggtaa

DBGET integrated database retrieval system