KEGG   Monodelphis domestica (opossum): 100023625Help
Entry
100023625         CDS       T01031                                 

Definition
chymotrypsinogen B-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     100023625
Peptidases [BR:mdo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100023625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 269 aa AA seqDB search
MAFLQLFSCFALIAAALGESQQQLGCGVPAIEPMLSGLARIVNGEDAVPGSWPWQVSLQR
GGSHFCGGSLISENWVVTAAHCGVKTTDKVIAGEFNLGSDDDDIQVLQIAEVFKNKKFNM
ITVSDDIALLKLASPARLVETVSPVCLPSASDNFPEGTTCVTTGWGKTKYNAFRVPDKLQ
QAALPLVSTEKCKEFWGSKIKDTMICAGASGVSSCMGDSGGPLVCLKNGAWTLTGIVSWR
SGTCSTSTPAVYARVTELLPWIEETLANN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggctttccttcagctcttctcctgctttgccctcatcgctgcagctttgggtgagagc
cagcaacagctaggatgtggcgtccctgccattgagcccatgctgtctggcctggccaga
attgtcaatggtgaagatgcagttcctggttcttggccttggcaagtttccctgcagaga
ggaggttcccacttctgcgggggctccctcatcagcgagaactgggtggtcacagctgct
cactgcggggtcaagacaaccgacaaggtcattgctggagagtttaacctgggctctgac
gatgacgacatccaggttctgcagattgctgaggtcttcaagaacaaaaagtttaacatg
atcaccgtcagtgatgacatcgccctgttgaagctggcttcacctgctcgacttgtggag
accgtgtcccctgtctgcctgcccagtgccagtgataatttccctgaaggcaccacctgt
gtcactactggctggggcaagaccaagtacaatgccttcagagtcccagacaagctgcag
caggctgctctgcccctggtgtccaccgaaaaatgcaaagagttctggggaagcaagatc
aaggacaccatgatctgtgctggagccagtggtgtttcttcctgcatgggtgactctggt
ggacccctggtctgcctgaaaaatggcgcctggaccctgactggcattgtctcctggaga
agcggaacctgctccaccagcacacccgctgtgtatgcccgggtcacagagctcctcccc
tggatcgaggaaaccctggccaacaactga

DBGET integrated database retrieval system