KEGG   Monodelphis domestica (opossum): 100023713Help
Entry
100023713         CDS       T01031                                 

Definition
uncharacterized LOC100023713
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100023713
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100023713
Peptidases [BR:mdo01002]
 Metallo Peptidases
  Family M67
   100023713
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 670 aa AA seqDB search
MAPPGPRAPSPHPPVPKRAPSGPEGRLREEAPAHPGCRALRQASLPRPHRPRPRRLFLEK
LPKHRDYKTAVIPEKKDTVKKLKEVAFPKAEELKKELLKRYTREYVDYTGRKVSAPPSQS
PLTREETGAASWCWSGAQGRQHSRGAGAPRRGHTGSSCRLPGPVLRAGAEPCGRRDSGVR
GEKAEPGQRRSGGRGHHEDAAGGEQPSWGEPLDFTGGLEEEEGRGAAGEAPSLFSLYGRL
SRENPAPFWCPPCHRPRAALWIKAGFVSSKALLIPKGLGQGQRWADRARRAAPGLRAPAG
PWRTTGDGRGRRHRAQLGGGEPEEAEPSGHSPGLHAGACICQNVAGMRLFVGKMRGEERA
GPLALPSARIIRGRPCPPLAAPALPPVPDGPCRRRFPICRRRKAKQPGGGRSSLAASLWI
SFPGRVVRLLVAGTPAGGPCPTPAHLTDEETEASSRSAQAPVTSDEGPCVSGSGRAEEAR
GGPRLTFALLPLAAPPLNGLRHVVVPQTLCPQFLQLADGNTVRGVETCGILCGKLTKNEF
TVTHVLVPKQSSGPDYCNTESEEELFHIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCS
YQMMLPESIAIVCSPKFQETGFFRLTDHGLEEISSCRQKGFHPHCKDPPLFCTCSHVTVV
DRAVAITDLR
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgcccggaccccgagcgccctcgccccatccccctgtgcccaaacgggctcca
tcaggcccagaagggcggctccgggaagaagctcctgcccacccgggctgcagggccctc
aggcaggcctcgctcccccgacctcatcggcctcgtcctcgcaggctcttcctcgagaag
ctccccaaacacagagactacaagacggccgtcatccccgagaagaaggacaccgtgaag
aaactcaaggaggtggcgttccccaaagcggaggagctgaagaaggagctgctgaagaga
tacacccgagagtacgtggactacacgggcaggaaggtgagcgccccccccagccagagc
cctctgacccgggaggaaaccggggcggcctcgtggtgctggtctggcgcgcaggggagg
cagcactcccggggagcaggggccccgcggcgggggcacacgggaagctcttgccggctg
ccggggcctgtgctaagggctggagcagagccttgtgggagacgggattccggggtgaga
ggcgagaaggcagagcccgggcaaaggcgcagtggggggagagggcaccatgaggatgct
gctggaggggagcagccaagctggggagagccgctggacttcacaggagggctagaagaa
gaggagggccgaggggccgccggagaggctcccagccttttctctctctacggtcgtctc
tcaagagaaaatcctgcccctttctggtgcccgccctgccaccggccccgggctgctctc
tggataaaggcaggatttgtctcctccaaagcccttctgatccctaaaggcctcggccaa
ggccaacgttgggctgacagagccaggagagccgctcccggccttcgtgcccccgccggc
ccctggagaacgacgggtgacggcagaggccgccggcatcgagcccagctcgggggaggg
gagcccgaggaagccgaaccgtccggccactcgccggggctccacgcaggagcttgtatt
tgtcagaatgtggcaggaatgcggctgtttgtggggaaaatgcgaggagaggagcgagcc
ggccctctggccctgccctccgcccgcatcatccgcggccggccttgtccccctctggcc
gccccggcgctgcccccggtgccggacggtccctgccggcggcgttttcccatttgtcgg
aggaggaaagcgaagcagccggggggaggcaggagcagcctggccgcaagcctttggata
agcttcccaggacgggtcgtccgcctcctcgtggcggggacaccggccggcgggccatgt
ccaactccagctcatttgacagatgaggaaactgaggcgagcagccggagcgcccaggct
ccggtgacctcggacgagggcccctgcgtgagcggcagcgggcgggcagaagaggctcgg
ggcggcccccgtctgacctttgccctcttgcccttggcagcgcccccgctcaacggactc
cgccacgtggtggtgccccagacgctctgtccgcagtttctccagctggccgacggcaac
acggtccggggcgtggagacgtgcgggatcctctgcgggaagctgacgaagaacgagttc
accgtcacccacgtgctggtccccaagcagagctccgggcccgactactgcaacacggag
agcgaggaggagctcttccacatccaggaccagcagggcctcatcaccctgggctggatc
cacacacatcccacccagacggccttcctgtccagcgtggacctgcacacgcactgctcc
taccagatgatgctgcccgagtccatcgccatcgtctgctcccccaagttccaggaaacg
gggttctttaggctgacagaccacggcctggaggagatttcttcttgtcgccagaaaggg
tttcatcctcactgcaaggacccccccctgttctgtacctgcagtcatgtgaccgttgtg
gaccgagccgtcgccatcactgaccttcgatga

DBGET integrated database retrieval system