KEGG   Monodelphis domestica (opossum): 100023713Help
Entry
100023713         CDS       T01031                                 

Gene name
STAMBP
Definition
(RefSeq) STAM binding protein
  KO
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100023713 (STAMBP)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100023713 (STAMBP)
Peptidases [BR:mdo01002]
 Metallo Peptidases
  Family M67
   100023713 (STAMBP)
Membrane trafficking [BR:mdo04131]
 Endosome - Lysosome transport
  Others
   Others
    100023713 (STAMBP)
Ubiquitin system [BR:mdo04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    100023713 (STAMBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
1
AA seq 682 aa AA seqDB search
MAPPGPRAPSPHPPVPKRAPSGPEGRLREEAPAHPGCRALRQASLPRPHRPRPRRLFLEK
LPKHRDYKTAVIPEKKDTVKKLKEVAFPKAEELKKELLKRYTREYVDYTGRKVSAPPSQS
PLTREETGAASWCWSGAQGRQHSRGAGAPRRGHTGSSCRLPGPVLRAGAEPCGRRDSGVR
GEKAEPGQRRSGGRGHHEDAAGGEQPSWGELCPPPVLVGGPRPLDFTGGLEEEEGRGAAG
EAPSLFSLYGRLSRENPAPFWCPPCHRPRAALWIKAGFVSSKALLIPKGLGQGQRWADRA
RRAAPGLRAPAGPWRTTGDGRGRRHRAQLGGGEPEEAEPSGHSPGLHAGACICQNVAGMR
LFVGKMRGEERAGPLALPSARIIRGRPCPPLAAPALPPVPDGPCRRRFPICRRRKAKQPG
GGRSSLAASLWISFPGRVVRLLVAGTPAGGPCPTPAHLTDEETEASSRSAQAPVTSDEGP
CVSGSGRAEEARGGPRLTFALLPLAAPPLNGLRHVVVPQTLCPQFLQLADGNTVRGVETC
GILCGKLTKNEFTVTHVLVPKQSSGPDYCNTESEEELFHIQDQQGLITLGWIHTHPTQTA
FLSSVDLHTHCSYQMMLPESIAIVCSPKFQETGFFRLTDHGLEEISSCRQKGFHPHCKDP
PLFCTCSHVTVVDRAVAITDLR
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgcccggaccccgagcgccctcgccccatccccctgtgcccaaacgggctcca
tcaggcccagaagggcggctccgggaagaagctcctgcccacccgggctgcagggccctc
aggcaggcctcgctcccccgacctcatcggcctcgtcctcgcaggctcttcctcgagaag
ctccccaaacacagagactacaagacggccgtcatccccgagaagaaggacaccgtgaag
aaactcaaggaggtggcgttccccaaagcggaggagctgaagaaggagctgctgaagaga
tacacccgagagtacgtggactacacgggcaggaaggtgagcgccccccccagccagagc
cctctgacccgggaggaaaccggggcggcctcgtggtgctggtctggcgcgcaggggagg
cagcactcccggggagcaggggccccgcggcgggggcacacgggaagctcttgccggctg
ccggggcctgtgctaagggctggagcagagccttgtgggagacgggattccggggtgaga
ggcgagaaggcagagcccgggcaaaggcgcagtggggggagagggcaccatgaggatgct
gctggaggggagcagccaagctggggagagctttgcccaccgccagttcttgtcggaggc
ccaaggccgctggacttcacaggagggctagaagaagaggagggccgaggggccgccgga
gaggctcccagccttttctctctctacggtcgtctctcaagagaaaatcctgcccctttc
tggtgcccgccctgccaccggccccgggctgctctctggataaaggcaggatttgtctcc
tccaaagcccttctgatccctaaaggcctcggccaaggccaacgttgggctgacagagcc
aggagagccgctcccggccttcgtgcccccgccggcccctggagaacgacgggtgacggc
agaggccgccggcatcgagcccagctcgggggaggggagcccgaggaagccgaaccgtcc
ggccactcgccggggctccacgcaggagcttgtatttgtcagaatgtggcaggaatgcgg
ctgtttgtggggaaaatgcgaggagaggagcgagccggccctctggccctgccctccgcc
cgcatcatccgcggccggccttgtccccctctggccgccccggcgctgcccccggtgccg
gacggtccctgccggcggcgttttcccatttgtcggaggaggaaagcgaagcagccgggg
ggaggcaggagcagcctggccgcaagcctttggataagcttcccaggacgggtcgtccgc
ctcctcgtggcggggacaccggccggcgggccatgtccaactccagctcatttgacagat
gaggaaactgaggcgagcagccggagcgcccaggctccggtgacctcggacgagggcccc
tgcgtgagcggcagcgggcgggcagaagaggctcggggcggcccccgtctgacctttgcc
ctcttgcccttggcagcgcccccgctcaacggactccgccacgtggtggtgccccagacg
ctctgtccgcagtttctccagctggccgacggcaacacggtccggggcgtggagacgtgc
gggatcctctgcgggaagctgacgaagaacgagttcaccgtcacccacgtgctggtcccc
aagcagagctccgggcccgactactgcaacacggagagcgaggaggagctcttccacatc
caggaccagcagggcctcatcaccctgggctggatccacacacatcccacccagacggcc
ttcctgtccagcgtggacctgcacacgcactgctcctaccagatgatgctgcccgagtcc
atcgccatcgtctgctcccccaagttccaggaaacggggttctttaggctgacagaccac
ggcctggaggagatttcttcttgtcgccagaaagggtttcatcctcactgcaaggacccc
cccctgttctgtacctgcagtcatgtgaccgttgtggaccgagccgtcgccatcactgac
cttcgatga

DBGET integrated database retrieval system