KEGG   Monodelphis domestica (opossum): 100023737Help
Entry
100023737         CDS       T01031                                 

Gene name
TTK
Definition
TTK protein kinase
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Cell cycle
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:mdo04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 867 aa AA seqDB search
MEDEDLSGKELPTITSIMNKVRDIKNKIKNEDLTDELNFNKVSADTSDNSGTVNRIMMTA
NNPENWLNFLLKIEKKSIPQNDGFLNKLIGRYSQAIEALPPDKYGQNESFARIQVRFAEL
KAIQEPDDARDCFQMAKANCKKFAFVHVSFAQFELSQGNFKKSKQLLQKAIECGAVPLEM
LKIAIQNLNLQKKQLLSEEEKNNFSATTILTTQESFQNPLGNLQNRNTNCDSRRPSNVAR
FLYGENIPPQDTEMSSRNPLKQLNKSKPSCPFGRVPVNLINSPDGTVKTDGPVGQSFIKR
QTPGSEYRDLIVPKPEEPSENDSYELKDIKTLQNIYSMDFQLAGEKSSELAPDLTITLRN
KTGSCLPTKKEENKAQYQEPKVPENNQILRQSNFSSSNRKSESLNQNSVVSSSQWQIPEA
NRNSVPEQKRSSFEQPGLTIPKQSPPVTAPKRTDNKFMCNTPSSSTLNDYMACFRTPVVK
NDFPPGPQFSTPYSQPSYLQQQQQTPATPFQSLQISGSFSSNEYISVKGRIYSILKQIGS
GGSSKVFQVLSEKKQIYAIKYVNLEEADHQTIESYRNEIAYLSKLQQHSDKIIRLYDYEI
TDHYIYMVMECGNIDLNSWLKKKKTINPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANF
LIVDGMLKLIDFGIANQIQPDMTSIIKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISP
KSDVWSLGCILYCMTYGKTPFQHIINQITKLHAIIDPNHEIEFPEIAEKDLQDVLKCCLI
RDPKQRISVPELLVHPYVQIQTQSQPGGQVIKGTTEEMKHVLGQLVGLNSPNSILKAART
LYEQYSSGDSHDSSSFAKPYDQKWKKK
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggaagacgaggatctaagcggtaaagaattgccaacaatcacttccattatgaacaaa
gttagagatattaaaaataagattaagaatgaggatcttactgatgagttgaattttaat
aaagtctctgcagatacttctgacaattcaggaactgttaaccgaattatgatgacagca
aacaacccagagaactggttgaattttttgctaaaaatagaaaaaaaaagtattcctcaa
aatgatggatttctaaataaattgattggccgttatagtcaagcaattgaagctcttcct
ccagacaaatatggtcaaaatgaaagttttgctcgaattcaagtgagatttgctgaattg
aaagctattcaagaaccagatgatgcacgtgactgctttcagatggccaaggctaactgc
aagaaatttgcttttgtgcatgtgtcttttgcacagtttgaactatctcaaggtaacttc
aaaaaaagtaagcaacttcttcaaaaggctatagaatgtggcgcagtcccactagaaatg
ttaaaaattgccatacaaaatttaaatctacagaaaaaacaattgctttcagaggaggaa
aaaaataacttttcagcaactaccattttaaccacccaagaatcattccaaaaccctctt
ggaaatttacagaatagaaatactaattgtgattccagaagaccatctaatgtggccaga
tttttatatggggaaaatatacctcctcaagatacagagatgagtagtagaaatcccttg
aagcaattaaacaaatctaaaccatcatgcccatttggaagagttccagttaaccttatt
aatagcccagatggaactgtgaagacagatggtccagttggtcagagttttataaaaaga
caaactcctggatcagaatatagagatttgattgtaccgaaaccagaagaaccaagtgaa
aatgattcatatgagttaaaagatataaagacacttcaaaatatctactccatggatttt
cagttagcaggtgagaagagttcagagcttgctcctgatttaacaataacactaaggaat
aaaacaggatcttgtcttccaaccaaaaaagaagaaaacaaagcacagtatcaagaacca
aaagtaccagaaaataaccagatccttcgacaatctaatttcagtagtagtaatagaaaa
tcagagtccttaaaccaaaattctgtggtgtcttctagtcagtggcaaattccagaggca
aaccgaaattctgtaccagagcaaaaacgttccagttttgaacaacctggcttaacaatt
ccaaaacaatctccaccagtaacagctcctaaaagaactgataacaaatttatgtgcaac
acacctagcagcagcacactaaatgactacatggcctgttttagaactccagttgtaaag
aatgactttccaccaggacctcagttttctactccttacagtcaaccttcctacttacag
cagcaacaacaaacaccagcaactccatttcaaagcttacagatttcaggatcattttct
tcaaatgaatatatttcagttaaaggaagaatttattccatattaaagcagataggaagt
ggaggttcaagtaaggtttttcaagtattgagtgaaaagaagcagatatatgctatcaaa
tatgtgaatttggaagaagctgaccatcaaaccattgagagctaccggaatgaaattgct
tatttgagtaaattacaacaacacagtgataagatcattcgactttatgattatgaaatc
actgaccactatatttatatggtgatggaatgtggaaacatcgatcttaatagttggctt
aaaaagaaaaaaacaatcaatccttgggaacgcaaaagttactggaaaaacatgttggaa
gcagttcatacaatccaccagcatggcattgttcatagtgatctgaaacctgctaacttc
ctgatagttgatggaatgcttaagctaattgattttgggattgccaaccaaatacagcca
gatatgacaagcattattaaagattctcaggttggtacagttaattatatgccaccagaa
gccatcaaagatatgtcttcttcaagagagaatgggaaatcaaaatcaaagataagccca
aaaagtgatgtgtggtccttaggatgcattttatactgcatgacttatgggaagactccg
tttcagcatataataaatcagatcactaagttacatgctataattgatcctaatcatgaa
atagaattccctgaaattgctgaaaaagatctacaggatgtactaaagtgttgcttaata
agggatcctaaacagagaatatctgttcctgaactcttagtacatccatatgttcagatt
caaactcagtcacaaccaggtggtcaagtcattaagggaaccacagaggaaatgaaacat
gttcttggccagcttgttggcctgaattctcctaactctattttaaaagctgccagaact
ttatatgaacagtacagcagtggagatagccatgattcatcatcatttgccaaaccatat
gaccaaaaatggaaaaagaaatga

DBGET integrated database retrieval system