KEGG   Monodelphis domestica (opossum): 100023838Help
Entry
100023838         CDS       T01031                                 

Gene name
EHMT1
Definition
euchromatic histone-lysine N-methyltransferase 1
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100023838 (EHMT1)
Enzymes [BR:mdo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100023838 (EHMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1332 aa AA seqDB search
MLESIFSLKWMELTSDRPVRGRLPLFCVVVYWEQAVLSKGETKKDTCMKTELLKDITNNK
EEGGNDMAADESSTEKQGGEPQMAADGETNGSCERNEANSHPNPAKHTQDNTKASPQEPA
KLRIAENGISERDSDFGKQNHVKASDFTQTSLTGSNGYILTKPTLPEQPIRTTSTLASSL
PGHAAKTLPGGPSKGRTLSSFPHAQAAMPTKLGEGSKDLDHKKPTTTNPDVKVHRARKTM
PKSIPSLHAASKDPREVRDSRDHKESKEESNKNVTEFGKQQLLPPLSSLHQSLPQNQCYM
TTTKSQTACLPFVLAAAVSRKKKRRMGTYSLVPKKKTKVLKQRTVIEMFKSIAHSTVGTK
SEKDVGDSSLHVNGESLEIDSEEDDSDDLEEDEDHGSEQASAFPVDDNRISNEGISEIDR
AQKMEDGESEEEQESGESGEEEEDGDESDLSSESSIKKKLLKRKGKIDSPWIKPTRKRRR
RNKKKQSSVLGTETYKSSLGSTGQAGQENSMDYMEVSLDSLDLRVKGILSSQSEVLSNGP
EAVEIDGLQEVPLCSCRMETPKSREITTLANNQCMATESIDNELGRCTNNVVKYELMRPS
NNVQLLVLCEDHRGKMVKHQCCPGCGYFCTAGNFMECQPESSISHRFHKDCASFVNNTSY
CPHCGEETSKAKEVTIAKADTTSTVSLTYVQEKPVTVEGRADTTTGSSGTHLSEEEKPES
STPQVPESGFELSGSSVFVKPTTGLSQGPVKETLESALIALDSEKPKKLRFHPKQLYFSA
RQGELQKVLLMLVDGIDPNFKMEHQNKRTPLHAAAESGHVDICHMLIQAGANIDTCSEDQ
RTPLMEASENNHLDAVKYLIKAGALVDPKDAEGSTCLHLAAKKGHYDVVQYLLSNGQMDV
NCQDDGGWTPMIWATEYKHIDLVKLLLAKGSDINIRDNEENICLHWAAFSGCVEIAEILL
AAKCDLHAVNIHGDSPLHIAARENRYDCVVLFLSRGSDVTLKNKEGETPIQCSSLNSQVW
GALQMNKTLQESSNEKPAQIERTMSRDIARGYERIPIPCVNAVDNEPCPSNYKYVSQNCV
TSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECN
HACSCWRNCRNRVVQNGLRARLQLYRTQNMGWGVRSMQDIPLGTFVCEYVGELISDSEAD
VREEDSYLFDLDNKDGEVYCIDARFYGNISRFINHLCEPNLIPVRVFMSHQDLRFPRIAF
FSTRQIEAGEELGFDYGDRFWDIKGKFFSCQCGSPKCKHSSAALAQRQASSSQDTQENGL
PDTSSAAAADPF
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atgttggaaagtattttttccctaaagtggatggagctgacttctgataggccagtaagg
ggaagactaccccttttttgtgtggtagtttactgggagcaagcagtgttgagtaagggg
gagactaagaaggatacctgcatgaagactgaactgctgaaagatatcacaaacaataaa
gaagaagggggtaatgacatggctgctgatgaaagttcaacagaaaagcaaggaggggag
cctcagatggcagcagatggtgaaacaaatggttcttgtgaaagaaatgaagccaatagt
catcccaatccagctaaacacactcaggacaatacaaaagccagcccacaggagcctgct
aagttaagaatagctgaaaacggaatttctgagagagatagtgactttgggaaacaaaat
catgtgaaagctagtgatttcactcagacttctctcacaggaagtaatggctatatctta
accaaaccgacattaccagaacaacccataaggactaccagcaccttggcttcttctctt
ccaggccatgctgcaaaaacacttcctggaggacccagcaagggaagaactctaagctca
tttcctcacgctcaggctgcaatgcccaccaagcttggtgaggggagtaaagatctagat
cataagaaacccaccactacaaatcctgatgtcaaagtccatagagcacggaagactatg
cctaagtccattcccagcctgcatgcagccagtaaggaccccagagaagttcgagattct
agagatcataaagaatcaaaggaggaaagcaacaaaaatgttacggagtttggaaaacag
cagcttttgccccctctctcatcccttcatcagtcgctacctcagaaccaatgctacatg
accaccacaaagtcacagacagcttgcttgccttttgttttagcagctgcagtatctcgg
aagaaaaaacggagaatgggaacctacagcctggttcctaagaaaaagaccaaagtttta
aagcagaggacggtgattgagatgtttaagagcatagctcattccactgtgggcaccaag
agtgagaaggatgtaggtgacagtagccttcatgtaaatggagagagcttggagattgac
tcagaagaggatgactctgatgatttggaagaggatgaagatcatggatctgagcaagcc
tctgcatttcctgtagatgacaataggatttctaatgagggcatatctgaaattgatcgg
gcccaaaagatggaagatggggagtctgaagaggagcaagaatctggagaatctggggag
gaagaagaagatggggatgaatctgatttgagttcagaatctagcattaagaagaagctt
ctaaaacggaaaggaaagatagacagcccatggattaaaccaaccaggaaaaggaggagg
agaaataaaaagaaacaaagcagtgtcttaggtactgaaacatacaagtcatctttggga
agcacaggacaagctgggcaggaaaatagtatggactatatggaggtttctctggattct
ctggatctccgagtaaagggaattttatcttcacaatcagaagttctatccaatggccct
gaagcagtggaaatcgacggccttcaggaagtgcctctctgtagctgccgaatggaaact
ccaaaaagtcgtgagattaccacattagccaacaatcagtgtatggccactgaaagtata
gacaatgagttgggaagatgcacaaacaatgtggttaaatatgagttgatgcgtccatca
aataatgtccagctcttggtgctatgtgaggaccatagagggaaaatggtgaaacatcag
tgctgccctggttgtgggtacttctgcacagctggcaattttatggaatgtcaacctgaa
agtagcatatctcatcgttttcataaggattgtgcctcctttgtcaataatacaagctat
tgccctcattgtggggaagagacctcaaaagcaaaagaggtcaccatagccaaagcagac
actacttccacagtgtcgcttacttatgtccaagaaaaaccagtcactgtagagggaagg
gctgacactacaacaggtagcagtggaacacatttgtctgaggaggaaaagccagagagt
tcaactcctcaagttcctgaatcaggcttcgaattgtctgggtcgtcagtttttgttaag
cctactacaggactttcacaaggaccagtaaaagaaaccttggaaagtgctttgattgct
ttggattcagaaaaaccgaagaagttacgtttccacccaaagcagttatatttttctgcc
cgacaaggagaactgcaaaaagtgctccttatgttagttgatgggattgatccaaacttt
aaaatggaacaccagaataaaagaactccacttcatgcagctgcagagtctggccatgtg
gacatctgtcatatgttgattcaggctggtgctaatattgacacctgttcagaagatcag
agaaccccactgatggaggcatcggaaaacaaccatttggatgctgtaaaatacctcatc
aaggctggagcattagtagatcctaaggatgcagagggctccacatgcttgcacctagct
gccaagaaaggccactatgatgtggttcagtatttgctctcaaatggacagatggatgtc
aattgccaggatgatggtggttggacaccaatgatttgggccactgaatataaacatatt
gatctcgtgaagctcttgctagctaaaggatcagacatcaacatacgagacaatgaagaa
aatatttgtttgcattgggcagctttctcaggctgtgttgaaatagcagagatattgttg
gctgccaagtgtgatttacatgcagtaaacattcatggagactcacccttgcacattgca
gccagggaaaaccgctatgattgtgtagtcctctttctctctcgtggttctgatgtcacc
ctaaagaacaaggagggagaaacaccaatccagtgttccagtctcaactctcaggtctgg
ggggctcttcaaatgaataagactctccaagaatcttccaatgagaaacctgcccaaata
gaaaggacaatgagtagagacattgctcgaggctatgaacgaattcccattccttgtgtc
aatgctgtggacaatgagccatgccctagtaactacaagtatgtttcccagaattgtgtg
acatcccctatgaacattgatagaaacattacacatttgcagtactgtgtgtgcatagat
gattgctcttccagcaactgcatgtgtggccagctcagtatgcggtgttggtacgacaag
gatggtcgactcttgcctgaattcaacatggcagaacctcctttgatctttgagtgcaat
catgcttgttcttgttggagaaattgccgaaatagggttgttcaaaatgggctcagggct
cggttacaactttatcggacacaaaatatgggttggggtgtacggtccatgcaagacatt
ccactgggaacctttgtttgcgaatatgttggagagctgatttctgattcagaagctgat
gtcagagaagaggattcctatctctttgatctggacaacaaggatggagaagtttactgc
atagatgcccgtttctatggcaatatcagccgttttattaaccatctctgtgagcccaac
ctcattcctgtgcgtgtcttcatgtcacatcaagatttgcgcttccctcggattgccttc
ttcagtactcggcagatagaagcaggagaagaactagggttcgactatggagacagattc
tgggacatcaaaggcaagttttttagctgtcaatgtggatcccccaagtgcaaacactcc
agtgcagccctggcccagcgtcaggccagctcttcccaggatacccaagagaacgggctc
cctgatactagctcagctgcagctgctgaccctttttga

DBGET integrated database retrieval system