KEGG   Monodelphis domestica (opossum): 100023838Help
Entry
100023838         CDS       T01031                                 

Gene name
EHMT1
Definition
(RefSeq) euchromatic histone lysine methyltransferase 1
  KO
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Lysine degradation
Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100023838 (EHMT1)
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    100023838 (EHMT1)
Enzymes [BR:mdo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100023838 (EHMT1)
Chromosome [BR:mdo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100023838 (EHMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1336 aa AA seqDB search
MEQGRVAVEAGPVCARRDGGGATVGAPGPWPPRILRWQAVLSKGETKKDTCMKTELLKDI
TNNKEEGGNDMAADESSTEKQGGEPQMAADGETNGSCERNEANSHPNPAKHTQDNTKASP
QEPAKLRIAENGISERDSDFGKQNHVKASDFTQTSLTGSNGYILTKPTLPEQPIRTTSTL
ASSLPGHAAKTLPGGPSKGRTLSSFPHAQAAMPTKLGEGSKDLDHKKPTTTNPDVKVHRA
RKTMPKSIPSLHAASKDPREVRDSRDHKESKEESNKNVTEFGKQQLLPPLSSLHQSLPQN
QCYMTTTKSQTACLPFVLAAAVSRKKKRRMGTYSLVPKKKTKVLKQRTVIEMFKSIAHST
VGTKSEKDVGDSSLHVNGESLEIDSEEDDSDDLEEDEDHGSEQASAFPVDDNRISNEGIS
EIDRAQKMEDGESEEEQESGESGEEEEDGDESDLSSESSIKKKLLKRKGKIDSPWIKPTR
KRRRRNKKKQSSVLGTETYKSSLGSTGQAGQENSMDYMEVSLDSLDLRVKGILSSQSEVL
SNGPEAVEIDGLQEVPLCSCRMETPKSREITTLANNQCMATESIDNELGRCTNNVVKYEL
MRPSNNVQLLVLCEDHRGKMVKHQCCPGCGYFCTAGNFMECQPESSISHRFHKDCASFVN
NTSYCPHCGEETSKAKEVTIAKADTTSTVSLTYVQEKPVTVEGRADTTTGSSGTHLSEEE
KPESSTPQVPESGFELSGSSVFVKPTTGLSQGPVKETLESALIALDSEKPKKLRFHPKQL
YFSARQGELQKVLLMLVDGIDPNFKMEHQNKRTPLHAAAESGHVDICHMLIQAGANIDTC
SEDQRTPLMEASENNHLDAVKYLIKAGALVDPKDAEGSTCLHLAAKKGHYDVVQYLLSNG
QMDVNCQDDGGWTPMIWATEYKHIDLVKLLLAKGSDINIRDNEENICLHWAAFSGCVEIA
EILLAAKCDLHAVNIHGDSPLHIAARENRYDCVVLFLSRGSDVTLKNKEGETPIQCSSLN
SQVWGALQMNKTLQESSNEKPAQIERTMSRDIARGYERIPIPCVNAVDNEPCPSNYKYVS
QNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLI
FECNHACSCWRNCRNRVVQNGLRARLQLYRTQNMGWGVRSMQDIPLGTFVCEYVGELISD
SEADVREEDSYLFDLDNKDGEVYCIDARFYGNISRFINHLCEPNLIPVRVFMSHQDLRFP
RIAFFSTRQIEAGEELGFDYGDRFWDIKGKFFSCQCGSPKCKHSSAALAQRQASSSQDTQ
ENGLPDTSSAAAADPF
NT seq 4011 nt NT seq  +upstreamnt  +downstreamnt
atggagcaggggcgggtcgccgtggaggcggggcctgtgtgcgcgaggcgggacgggggc
ggggccacagtcggggcacccgggccatggccgccgcggattctgaggtggcaagcagtg
ttgagtaagggggagactaagaaggatacctgcatgaagactgaactgctgaaagatatc
acaaacaataaagaagaagggggtaatgacatggctgctgatgaaagttcaacagaaaag
caaggaggggagcctcagatggcagcagatggtgaaacaaatggttcttgtgaaagaaat
gaagccaatagtcatcccaatccagctaaacacactcaggacaatacaaaagccagccca
caggagcctgctaagttaagaatagctgaaaacggaatttctgagagagatagtgacttt
gggaaacaaaatcatgtgaaagctagtgatttcactcagacttctctcacaggaagtaat
ggctatatcttaaccaaaccgacattaccagaacaacccataaggactaccagcaccttg
gcttcttctcttccaggccatgctgcaaaaacacttcctggaggacccagcaagggaaga
actctaagctcatttcctcacgctcaggctgcaatgcccaccaagcttggtgaggggagt
aaagatctagatcataagaaacccaccactacaaatcctgatgtcaaagtccatagagca
cggaagactatgcctaagtccattcccagcctgcatgcagccagtaaggaccccagagaa
gttcgagattctagagatcataaagaatcaaaggaggaaagcaacaaaaatgttacggag
tttggaaaacagcagcttttgccccctctctcatcccttcatcagtcgctacctcagaac
caatgctacatgaccaccacaaagtcacagacagcttgcttgccttttgttttagcagct
gcagtatctcggaagaaaaaacggagaatgggaacctacagcctggttcctaagaaaaag
accaaagttttaaagcagaggacggtgattgagatgtttaagagcatagctcattccact
gtgggcaccaagagtgagaaggatgtaggtgacagtagccttcatgtaaatggagagagc
ttggagattgactcagaagaggatgactctgatgatttggaagaggatgaagatcatgga
tctgagcaagcctctgcatttcctgtagatgacaataggatttctaatgagggcatatct
gaaattgatcgggcccaaaagatggaagatggggagtctgaagaggagcaagaatctgga
gaatctggggaggaagaagaagatggggatgaatctgatttgagttcagaatctagcatt
aagaagaagcttctaaaacggaaaggaaagatagacagcccatggattaaaccaaccagg
aaaaggaggaggagaaataaaaagaaacaaagcagtgtcttaggtactgaaacatacaag
tcatctttgggaagcacaggacaagctgggcaggaaaatagtatggactatatggaggtt
tctctggattctctggatctccgagtaaagggaattttatcttcacaatcagaagttcta
tccaatggccctgaagcagtggaaatcgacggccttcaggaagtgcctctctgtagctgc
cgaatggaaactccaaaaagtcgtgagattaccacattagccaacaatcagtgtatggcc
actgaaagtatagacaatgagttgggaagatgcacaaacaatgtggttaaatatgagttg
atgcgtccatcaaataatgtccagctcttggtgctatgtgaggaccatagagggaaaatg
gtgaaacatcagtgctgccctggttgtgggtacttctgcacagctggcaattttatggaa
tgtcaacctgaaagtagcatatctcatcgttttcataaggattgtgcctcctttgtcaat
aatacaagctattgccctcattgtggggaagagacctcaaaagcaaaagaggtcaccata
gccaaagcagacactacttccacagtgtcgcttacttatgtccaagaaaaaccagtcact
gtagagggaagggctgacactacaacaggtagcagtggaacacatttgtctgaggaggaa
aagccagagagttcaactcctcaagttcctgaatcaggcttcgaattgtctgggtcgtca
gtttttgttaagcctactacaggactttcacaaggaccagtaaaagaaaccttggaaagt
gctttgattgctttggattcagaaaaaccgaagaagttacgtttccacccaaagcagtta
tatttttctgcccgacaaggagaactgcaaaaagtgctccttatgttagttgatgggatt
gatccaaactttaaaatggaacaccagaataaaagaactccacttcatgcagctgcagag
tctggccatgtggacatctgtcatatgttgattcaggctggtgctaatattgacacctgt
tcagaagatcagagaaccccactgatggaggcatcggaaaacaaccatttggatgctgta
aaatacctcatcaaggctggagcattagtagatcctaaggatgcagagggctccacatgc
ttgcacctagctgccaagaaaggccactatgatgtggttcagtatttgctctcaaatgga
cagatggatgtcaattgccaggatgatggtggttggacaccaatgatttgggccactgaa
tataaacatattgatctcgtgaagctcttgctagctaaaggatcagacatcaacatacga
gacaatgaagaaaatatttgtttgcattgggcagctttctcaggctgtgttgaaatagca
gagatattgttggctgccaagtgtgatttacatgcagtaaacattcatggagactcaccc
ttgcacattgcagccagggaaaaccgctatgattgtgtagtcctctttctctctcgtggt
tctgatgtcaccctaaagaacaaggagggagaaacaccaatccagtgttccagtctcaac
tctcaggtctggggggctcttcaaatgaataagactctccaagaatcttccaatgagaaa
cctgcccaaatagaaaggacaatgagtagagacattgctcgaggctatgaacgaattccc
attccttgtgtcaatgctgtggacaatgagccatgccctagtaactacaagtatgtttcc
cagaattgtgtgacatcccctatgaacattgatagaaacattacacatttgcagtactgt
gtgtgcatagatgattgctcttccagcaactgcatgtgtggccagctcagtatgcggtgt
tggtacgacaaggatggtcgactcttgcctgaattcaacatggcagaacctcctttgatc
tttgagtgcaatcatgcttgttcttgttggagaaattgccgaaatagggttgttcaaaat
gggctcagggctcggttacaactttatcggacacaaaatatgggttggggtgtacggtcc
atgcaagacattccactgggaacctttgtttgcgaatatgttggagagctgatttctgat
tcagaagctgatgtcagagaagaggattcctatctctttgatctggacaacaaggatgga
gaagtttactgcatagatgcccgtttctatggcaatatcagccgttttattaaccatctc
tgtgagcccaacctcattcctgtgcgtgtcttcatgtcacatcaagatttgcgcttccct
cggattgccttcttcagtactcggcagatagaagcaggagaagaactagggttcgactat
ggagacagattctgggacatcaaaggcaagttttttagctgtcaatgtggatcccccaag
tgcaaacactccagtgcagccctggcccagcgtcaggccagctcttcccaggatacccaa
gagaacgggctccctgatactagctcagctgcagctgctgaccctttttga

DBGET integrated database retrieval system