KEGG   Monodelphis domestica (opossum): 100023951Help
Entry
100023951         CDS       T01031                                 

Definition
gem-associated protein 7-like
Orthology
K13135  
gem associated protein 7
Organism
mdo  Monodelphis domestica (opossum)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:mdo03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 147 aa AA seqDB search
MPEKELPGPEPASKTRGAGYRREAPPFAGETRQIPTPVPVIRLPRGPDGTSRGFSAVRGQ
DRAGSLAEVAEQRVRAALRERYLRSILAMVGRPVHFTLHERVQVDAQFGATDLDVANFHV
SQLQTPLGVQGEALLRCADIISYSFQL
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagaaggaattacccggtcccgagcccgcctccaaaactcgaggcgccggctac
cggagagaggcgccgccgttcgctggtgagaccagacagatcccaactccagtccctgtg
atccgccttccccgaggcccagatggcaccagccggggcttcagtgctgtccggggccag
gacagggctggttcattggcagaggtggctgagcaacgggtacgagctgcccttcgggag
cgctatctccggagcatccttgccatggtggggcgtcctgtccactttaccctgcatgag
cgtgtccaggtggatgcccagtttggggccactgaccttgacgtggccaacttccatgtg
tctcagctgcagacaccccttggggtgcagggggaggccctgctacgctgtgctgacatc
atctcttactctttccagctgtga

DBGET integrated database retrieval system