KEGG   Monodelphis domestica (opossum): 100023951Help
Entry
100023951         CDS       T01031                                 

Gene name
GEMIN7
Definition
gem (nuclear organelle) associated protein 7
Orthology
K13135  
gem associated protein 7
Organism
mdo  Monodelphis domestica (opossum)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100023951 (GEMIN7)
Spliceosome [BR:mdo03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    100023951 (GEMIN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 147 aa AA seqDB search
MPEKELPGPEPASKTRGAGYRREAPPFAGETRQIPTPVPVIRLPRGPDGTSRGFSAVRGQ
DRAGSLAEVAEQRVRAALRERYLRSILAMVGRPVHFTLHERVQVDAQFGATDLDVANFHV
SQLQTPLGVQGEALLRCADIISYSFQL
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagaaggaattacccggtcccgagcccgcctccaaaactcgaggcgccggctac
cggagagaggcgccgccgttcgctggtgagaccagacagatcccaactccagtccctgtg
atccgccttccccgaggcccagatggcaccagccggggcttcagtgctgtccggggccag
gacagggctggttcattggcagaggtggctgagcaacgggtacgagctgcccttcgggag
cgctatctccggagcatccttgccatggtggggcgtcctgtccactttaccctgcatgag
cgtgtccaggtggatgcccagtttggggccactgaccttgacgtggccaacttccatgtg
tctcagctgcagacaccccttggggtgcagggggaggccctgctacgctgtgctgacatc
atctcttactctttccagctgtga

DBGET integrated database retrieval system