KEGG   Monodelphis domestica (opossum): 100024015Help
Entry
100024015         CDS       T01031                                 

Definition
lysosomal thioesterase PPT2-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:mdo01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:mdo00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:mdo04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 302 aa AA seqDB search
MLGFWGPQLPVLGVVLLLPLLPLLLPVAPTSPKVPYKPIIIVHGLFDSSSTFRHLLQYIN
QTHPGTLVTVLDLFDGGESLRPLWEQVQGFREAVTPIMKQSPHGVHLLCYSQGGLICRAL
LSVMDEHNVDTFISLSSPQMGQYGDTDYLKWLFPTSMRSNLYRVCYSPWGQEFSICNYWH
DPHHPDLYLNASSFLALINGERDHPNATVWRKNFLRVKRVILIGGPDDGVITPWQSSFFG
FYDANETVLEMEEQQVYLRDSFGLKTLSARGAIVRCSTPGIPHTAWHSNRSLYEACIEPW
LS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgctggggttctgggggcctcagctccccgtactgggagtcgtgttgctactgcctttg
ctgcctctcttgctgcccgtggctcccacgtccccgaaagttccctacaaacctatcatc
atagtgcatggactctttgatagctcttccacctttaggcacctgctgcaatacatcaac
cagacacatccggggacactggtgacagtattggatctttttgatgggggtgagagtctt
cggccactgtgggaacaggtacaaggattccgggaagctgtgacccctatcatgaagcag
tccccccatggagtacatctcctctgctattcccaggggggccttatctgccgggcactc
ctctctgtcatggatgagcacaatgtggatactttcatctccctctcatctccacagatg
gggcagtatggagatacagactacctgaaatggttgttccctacctccatgaggtctaac
ttgtatcgagtctgctatagcccctggggccaggaattctccatctgtaactactggcac
gatccccatcaccctgacttgtacctcaatgccagcagcttcctggccctaattaatggg
gaaagagaccatccaaatgccactgtgtggcggaagaactttctccgagtgaagcgtgtg
attctgatcggggggccagatgatggtgttattactccttggcagtccagcttttttggc
ttctatgacgcaaatgagacagtattggagatggaagagcagcaggtttatctacgggat
tcctttgggttgaagactttgtctgcccgaggggccattgtgaggtgctcaacgcctggg
atcccccatactgcatggcactccaaccgctcactctatgaggcctgcattgaaccttgg
ctttcctga

DBGET integrated database retrieval system