KEGG   Monodelphis domestica (opossum): 100024015Help
Entry
100024015         CDS       T01031                                 

Gene name
PPT2
Definition
palmitoyl-protein thioesterase 2
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100024015 (PPT2)
  Lipid metabolism
   00062 Fatty acid elongation
    100024015 (PPT2)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100024015 (PPT2)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100024015 (PPT2)
Lipid biosynthesis proteins [BR:mdo01004]
 Fatty acid synthase
  Component type
   100024015 (PPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 302 aa AA seqDB search
MLGFWGPQLPVLGVVLLLPLLPLLLPVAPTSPKVPYKPIIIVHGLFDSSSTFRHLLQYIN
QTHPGTLVTVLDLFDGGESLRPLWEQVQGFREAVTPIMKQSPHGVHLLCYSQGGLICRAL
LSVMDEHNVDTFISLSSPQMGQYGDTDYLKWLFPTSMRSNLYRVCYSPWGQEFSICNYWH
DPHHPDLYLNASSFLALINGERDHPNATVWRKNFLRVKRVILIGGPDDGVITPWQSSFFG
FYDANETVLEMEEQQVYLRDSFGLKTLSARGAIVRCSTPGIPHTAWHSNRSLYEACIEPW
LS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgctggggttctgggggcctcagctccccgtactgggagtcgtgttgctactgcctttg
ctgcctctcttgctgcccgtggctcccacgtccccgaaagttccctacaaacctatcatc
atagtgcatggactctttgatagctcttccacctttaggcacctgctgcaatacatcaac
cagacacatccggggacactggtgacagtattggatctttttgatgggggtgagagtctt
cggccactgtgggaacaggtacaaggattccgggaagctgtgacccctatcatgaagcag
tccccccatggagtacatctcctctgctattcccaggggggccttatctgccgggcactc
ctctctgtcatggatgagcacaatgtggatactttcatctccctctcatctccacagatg
gggcagtatggagatacagactacctgaaatggttgttccctacctccatgaggtctaac
ttgtatcgagtctgctatagcccctggggccaggaattctccatctgtaactactggcac
gatccccatcaccctgacttgtacctcaatgccagcagcttcctggccctaattaatggg
gaaagagaccatccaaatgccactgtgtggcggaagaactttctccgagtgaagcgtgtg
attctgatcggggggccagatgatggtgttattactccttggcagtccagcttttttggc
ttctatgacgcaaatgagacagtattggagatggaagagcagcaggtttatctacgggat
tcctttgggttgaagactttgtctgcccgaggggccattgtgaggtgctcaacgcctggg
atcccccatactgcatggcactccaaccgctcactctatgaggcctgcattgaaccttgg
ctttcctga

DBGET integrated database retrieval system