KEGG   Monodelphis domestica (opossum): 100024144Help
Entry
100024144         CDS       T01031                                 

Gene name
PLCD3
Definition
phospholipase C, delta 3
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100024144 (PLCD3)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100024144 (PLCD3)
   04070 Phosphatidylinositol signaling system
    100024144 (PLCD3)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100024144 (PLCD3)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100024144 (PLCD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 804 aa AA seqDB search
MPCQCWRSRSSVVPGASFRILVSDCGSQERPRLRALKKMDLNEDEDVLAMLKGSQFCKIR
SLKWRKARFYRLQEDGLTVWFQRRFRHPKSHHVFFLQHIEAVRQGHESEGLRRYGSAFPA
GRCLTITFKNRRKNLDLAAATEEEAQRWVRGLAKLRARLDAMSQREKLDHWIHGYLHQAD
SDHDSKMSFKEIKHLLQMVNVTMDDMYAQQLFEECDSSKNERLEDAEIEEFLRRLLKRPE
LEEIFYRYSGEDRVLSAAELLEFLHDQGEEEATMAQAQHLIHTYELNDKAKQHDLMMLDG
FMMYLLSPEGAVLDPAHKDVYQDMNQPLSHYFISSSHNTYLTQSQIGGASSTEAYIRAFA
QGCRCVELDCWEGADGEPVVYHGHTFTSKILFRDVIQVVRDHAFSLSPYPVILSLENHCG
LQQQSTMAHYLRTILGNMLVTETLDGKIPKELPSPEQLKGKVLIKGKKQIVHQKEEPRSD
LPDEDKEDELKLLNITERRKSSTQKLEGSFLPYVEEKKEGKEEQDKESEEEREAGSGDHR
KQVSWGLRSRRGGHIDLLGLHGNSESKGKEKWKGWDPGLTISPCPGNNFIRCNTYQLCRV
YPLGLRMTSANYNPQEMWNGGCQLVALNFQTPGYEMDLNNGRFLVNGKCGYVLKPDFLRH
RDTTFDPEHPGAPQTTLIIKVLTAQQLPKLNREKPNSIVDPLVRVEIYGVPRDCAQKETD
YVLNNGFNPYWGQTLKFTLGAPELALVRFVVEDYDATSFNDFVGQFTLPLYSLKQGYRHI
HLFSKDGASLSPATLFVHIQIKNQ
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgccctgccagtgctggaggagtcggagcagcgtggtgccgggcgcctctttccggata
ctggtctcggactgcgggagtcaggaacggccccggctgcgagcgctgaagaagatggat
ctgaacgaagatgaggatgtgctggcgatgctgaagggctcccagttctgcaagatccgc
tctctcaaatggcggaaggcgcggttctatcggctgcaggaagatggtctcaccgtgtgg
ttccagcgccgcttccgacaccccaagtcgcatcacgtcttcttcttgcagcatatcgag
gcggtccgccagggccatgagtccgaggggctgcggcgctatggcagtgccttccctgcg
ggtcgctgcctcaccatcacgttcaagaacaggcgcaagaacctggacctggccgcggcc
actgaggaggaggcacagcgctgggtgcggggcctggccaagctccgggcgcgcctggac
gccatgagccagagggaaaaacttgaccactggatccatggctacctgcaccaggcagat
tcagaccatgacagcaagatgagtttcaaggagatcaaacacctccttcagatggtgaat
gtgacgatggatgacatgtatgcccaacaactcttcgaggagtgtgacagctctaagaat
gagcggcttgaggatgctgaaattgaggagttcctacggagactactgaaacggcctgag
ctggaggaaatcttctaccgatactctggggaagacagggtcctgagtgccgctgagctg
ctggagttcctccatgaccaaggggaggaagaagccaccatggcccaggctcagcacctg
atccatacctatgagctcaatgataaagctaaacagcatgacctgatgatgctggatggt
ttcatgatgtacttgctgtcgcctgagggtgctgttctggacccagctcacaaagatgta
taccaagacatgaatcagcccctctcccattactttatctcctcttcccataatacttac
ctgacccagtcccaaatcggtggtgccagcagcacagaggcctacatcagggcgtttgcc
cagggttgcaggtgtgtggaactggactgctgggagggcgcagatggagaacctgtggtt
tatcatgggcacacattcacctctaagatcctctttcgggatgtcatccaagtcgtgcgg
gaccatgccttctcgctgtccccgtacccagtcatcttatccctggagaatcactgtggg
ttacagcaacaatccaccatggctcactacctgcggaccatcttggggaacatgctggtg
acagaaaccctggatgggaaaattcccaaagagctgccctctccagagcagctgaagggc
aaggttctcataaagggcaagaaacaaatcgtccatcagaaagaagagcctcggtctgat
ctgcctgatgaagacaaagaagatgaacttaagctgttgaacatcacagagagaaggaag
tcgtctactcagaagttggaagggtctttcctaccctatgtagaggaaaagaaggaagga
aaggaggaacaagataaagaatctgaggaggagagagaggcagggtctggagaccataga
aaacaggtgagctgggggctaaggtccagaagagggggtcacatagatttgcttggctta
catgggaattcagagtccaaaggaaaggaaaaatggaagggttgggacccaggcttgacc
atctccccctgcccaggaaacaactttatccgatgtaacacttaccagctgtgtagagtc
taccctttggggctcaggatgacctctgccaattataacccccaggagatgtggaatggg
ggctgccagctggtggccttgaactttcagactcctgggtatgagatggacctgaataat
ggccgcttcctggtgaatgggaaatgcggctatgtcctgaaacctgattttctgaggcac
agagacacaacctttgaccctgaacaccctggggccccccagaccaccctcatcatcaag
gtgctgacagctcagcaattgcccaaattgaacagagagaagccaaattcgattgtggac
ccactggttcgagtggagatctatggggtacccagggactgtgcccagaaagagactgac
tatgtgctcaacaatggttttaatccttattgggggcagactctgaagttcacccttggg
gccccagagctggccttggttcgatttgtagtggaagactatgacgctacctccttcaat
gacttcgtgggccaattcaccctgcccttatacagcctaaagcaagggtaccgacacatc
cacctattctctaaggatggggcttctctctccccagccacactctttgtccacattcag
attaaaaaccagtga

DBGET integrated database retrieval system