KEGG   Monodelphis domestica (opossum): 100024187Help
Entry
100024187         CDS       T01031                                 

Gene name
MRPS18B
Definition
mitochondrial ribosomal protein S18B
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100024187 (MRPS18B)
Ribosome [BR:mdo03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    100024187 (MRPS18B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 246 aa AA seqDB search
MASSLLTLLLRRLPCLTPIKGVRWVQATPRALCTKATPEEESSTPVSPYQDAPWEYLETE
EYISRYGSRPVWADYRRNHKGGIPPQRTRRTCIRGNKVSGNPCPICRDQKLHVDFRNVKL
LEQFVCAHTGVIFHAPYTGVCMKQHKKLTEAILKARDQGLLSYHIPLVQPRDTDFSNSHG
AVGLTPMAPALAAGTAWYPWYTWQQPPERELARLRRLYQGHLKEESGPPPEMMPIVPSQT
DVLTEG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggcatcctctctcctaacactgctacttaggcggctcccgtgcctcacacctatcaaa
ggtgtccgctgggtgcaggctactcctcgggcactgtgcaccaaagctacccctgaggaa
gaatcttccaccccagtctccccttatcaggatgctccctgggaatatctggagacagaa
gaatacatctctcgttatggctcccgtccagtctgggctgattatcgacgcaaccacaaa
ggtggaatcccaccacagcgaacccgaaggacatgcattcgagggaataaagtttctggg
aacccttgccctatctgccgggatcagaagctccatgtggattttagaaatgtgaagctc
ttggagcagtttgtctgtgctcacacaggtgtcatcttccatgccccatatacaggtgtc
tgtatgaagcagcataaaaagctgacagaggctatcctgaaggccagagaccaaggttta
cttagctaccacatcccactggtacagccacgggatactgatttcagcaactcccatgga
gctgtgggccttacaccaatggctcctgccctagctgcaggtactgcctggtatccatgg
tacacgtggcagcagccacctgagagagagctggcccgtcttcgacgtttgtatcaaggc
caccttaaggaagagagtggccccccaccagagatgatgcccatagtcccatctcaaact
gatgttctcactgaaggatag

DBGET integrated database retrieval system