KEGG   Monodelphis domestica (opossum): 100024187Help
Entry
100024187         CDS       T01031                                 

Definition
28S ribosomal protein S18b, mitochondrial-like
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:mdo05203]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 246 aa AA seqDB search
MASSLLTLLLRRLPCLTPIKGVRWVQATPRALCTKATPEEESSTPVSPYQDAPWEYLETE
EYISRYGSRPVWADYRRNHKGGIPPQRTRRTCIRGNKVSGNPCPICRDQKLHVDFRNVKL
LEQFVCAHTGVIFHAPYTGVCMKQHKKLTEAILKARDQGLLSYHIPLVQPRDTDFSNSHG
AVGLTPMAPALAAGTAWYPWYTWQQPPERELARLRRLYQGHLKEESGPPPEMMPIVPSQT
DVLTEG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggcatcctctctcctaacactgctacttaggcggctcccgtgcctcacacctatcaaa
ggtgtccgctgggtgcaggctactcctcgggcactgtgcaccaaagctacccctgaggaa
gaatcttccaccccagtctccccttatcaggatgctccctgggaatatctggagacagaa
gaatacatctctcgttatggctcccgtccagtctgggctgattatcgacgcaaccacaaa
ggtggaatcccaccacagcgaacccgaaggacatgcattcgagggaataaagtttctggg
aacccttgccctatctgccgggatcagaagctccatgtggattttagaaatgtgaagctc
ttggagcagtttgtctgtgctcacacaggtgtcatcttccatgccccatatacaggtgtc
tgtatgaagcagcataaaaagctgacagaggctatcctgaaggccagagaccaaggttta
cttagctaccacatcccactggtacagccacgggatactgatttcagcaactcccatgga
gctgtgggccttacaccaatggctcctgccctagctgcaggtactgcctggtatccatgg
tacacgtggcagcagccacctgagagagagctggcccgtcttcgacgtttgtatcaaggc
caccttaaggaagagagtggccccccaccagagatgatgcccatagtcccatctcaaact
gatgttctcactgaaggatag

DBGET integrated database retrieval system