KEGG   Monodelphis domestica (opossum): 100024199Help
Entry
100024199         CDS       T01031                                 

Gene name
TACC3
Definition
transforming, acidic coiled-coil containing protein 3
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
mdo  Monodelphis domestica (opossum)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100024199 (TACC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 879 aa AA seqDB search
MSLQILNDENVSGDITAETCDFLFLLPELTGRSSVFCTSQKENVPPKNTAKTMKVTFQTP
LRDPQTNRILSPNMTRQLENCFTLDDGTDDLKNSQLPTSRCEKNQQVTKEVDSKTTSEEL
QRQETNPAPYPDDVLPVKSSDSYNIDLDILDDFNPFVTSSQIPRSYESLLKSEIVLEEEI
NCYSLDNTLPFISEGFKESPGIKSSKSPGKTLEKTCDSIRSASLVDKSTNEINRDPALKD
DSDGNVVIQNLIVNEMVPNKEQKSSLHSGQPEEPLSNTAQDPQSASVSTHLPACNPDFVN
NDEKKVIDSELPNFPLAEEKPVQAVGPLKYQPIKLEFDFSDNITLKPPPSKLGKGPAVKP
LSKKPPVTQGNVTKNLAKENTCQDKENIDPLPKGSYTLDWDKLNDPNFNPFGEKAKPSTF
DRQKSSNETTQHQENHIAQKDCPSTEEQNSVTVIDDISRNQQVIIPVAATADKSVLPVVE
TLIAVDQAEADAIQHQEKTENSSDTSVGTSIQVSPLLTTDSELHQKEELDTSAKIKAAIS
EEDFKSPSQVLGTDIEIDYLEQFGTSLFKESALRKQSLYLKFDPLLKESPNKLDPVTTAT
TNSLPDFMTSKQSQKNNQDNAKLDEFDFLGTLNIPVIGPPPLDGPECLDILDIPVPVPGL
PVSVDSIIDVLKYSQKDMDVAVEKVKQEVKEKEMQIQELEDKHKKFYVKYLEMGKIVEEY
EGMITQMIADSQKEKEVTKAEIQKISEEKQQITADLNSMEKSFSDLFKRLEKQREALEGY
QKNEEALKKCAQDYLLRIEKGEQRYQALKAHAEEKLNSANEEIAQVRSKAKAETLALQAN
LRKEQMRVQSLEKTLEQKTKENDELTKICDDLISKMEKI
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcagatcttaaatgacgaaaatgttagtggtgatataactgcagaaacttgt
gacttcctgtttttactacccgagctaacaggaagatcatctgtattttgtacatcccag
aaagaaaatgtaccaccaaaaaatacagcaaaaacgatgaaagtaacttttcaaactcct
ttgcgagatccacagacaaatagaattttaagcccaaacatgacacgccaacttgagaac
tgttttactctggatgatggtacagatgatttaaaaaattctcagctgcctacatcaaga
tgtgaaaaaaatcagcaggtaaccaaggaagttgacagtaaaactacgagtgaagagctt
caaagacaagaaacaaatcctgcaccttatccagatgatgtgctaccggtgaaaagcagt
gactcctacaatattgacttggatattctggatgattttaatccatttgtaacctcatcc
caaattccaaggtcttatgaaagtttattaaagtctgaaattgtcttagaagaagaaatt
aactgttactcattggataatactttaccatttatttctgaaggctttaaagagtctcca
ggaataaaatcttctaaaagccctggaaaaaccttggagaaaacctgtgatagtataaga
tctgcttcattggttgacaaaagcactaatgaaataaatagagatccagcattaaaggat
gattcagatggcaatgtggttattcagaatcttattgtgaatgaaatggtgcctaataaa
gagcagaaatcatctttgcactctggacaacctgaagaaccactttcgaatacagcgcaa
gatcctcagtctgctagtgtgtcaacacatttgccagcttgtaaccctgattttgtcaac
aatgatgaaaaaaaggttattgattctgaattaccaaattttcccctagcagaagaaaag
cctgttcaagcggttgggcctttgaaataccagcctataaaactagaatttgacttttct
gataatattactctcaagccaccaccaagtaaactagggaaggggcctgcagttaaacct
ctttccaagaaaccacctgtaactcaagggaatgtgacaaaaaacttggcaaaggaaaac
acatgtcaggataaagaaaatatcgaccctcttccaaagggatcttatactttagattgg
gacaagcttaatgatccaaactttaacccatttggagaaaaggctaagccttctactttt
gatcgccagaaatctagtaatgaaaccactcaacatcaagaaaatcacatagcacagaaa
gactgtccttccactgaggagcagaatagtgtgactgttattgatgacatatctagaaat
cagcaggttattatccctgttgctgctactgctgataaatctgtgctcccagtagtagaa
actttgatagcagtggatcaggcagaggcagatgctatccaacaccaggagaaaacagaa
aattcttcagatacttcagttggcacaagcattcaagttagtccattgttgaccactgac
tctgaactccaccagaaggaagaattggatacaagtgccaagataaaagctgccatctct
gaagaggacttcaagtctccttcacaagttctaggcacggacatagaaattgactatttg
gaacagtttggaacttctttatttaaggaatctgccttgagaaaacagtccttatatctt
aaatttgacccactactgaaagagagccccaataaactggatcctgtaactactgcaaca
actaatagccttcctgacttcatgacaagcaaacaatcccagaaaaataatcaagataat
gcaaaacttgatgaatttgacttcttgggaacacttaatattcctgtaataggacctcct
ccccttgatggaccagaatgtctggatattctggatattcctgtgccagtcccgggtttg
cctgtttcagttgattcgattatagatgtgttgaaatatagccagaaagacatggatgtg
gctgtagaaaaagttaaacaagaagttaaagaaaaagaaatgcaaattcaagaattggaa
gacaaacacaaaaaattctatgtgaaatatttagagatggggaaaattgtggaagaatat
gaagggatgataactcagatgatagcggattctcagaaggagaaagaagttacaaaggca
gaaatccagaagatttcagaagaaaaacaacaaattacagcagacctcaactccatggaa
aaatctttctcagacctcttcaaacgactagaaaaacagagggaggcattagaaggatat
caaaagaatgaagaagcactgaagaaatgtgctcaagattatctactaagaattgaaaag
ggagagcagcggtaccaagcattaaaggctcacgcagaagagaaattaaattcagcaaat
gaagaaattgcccaggttcggagcaaagcaaaagctgagactctggctttacaagcaaat
ttacgaaaggaacagatgagagtccagtcactagagaaaactctggaacaaaaaactaaa
gaaaatgatgaattgaccaaaatctgcgatgacttgatttcaaagatggaaaagatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system