KEGG   Monodelphis domestica (opossum): 100024307Help
Entry
100024307         CDS       T01031                                 

Gene name
GLS2
Definition
glutaminase 2 (liver, mitochondrial)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100024307 (GLS2)
   00330 Arginine and proline metabolism
    100024307 (GLS2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    100024307 (GLS2)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    100024307 (GLS2)
  Nervous system
   04724 Glutamatergic synapse
    100024307 (GLS2)
   04727 GABAergic synapse
    100024307 (GLS2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100024307 (GLS2)
   05206 MicroRNAs in cancer
    100024307 (GLS2)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     100024307 (GLS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 579 aa AA seqDB search
MPLPWDLGVWVRPTRAIFRGPSGRGLSHIDPSECTAASDSSESGMLSRLGDLLFYTIAEG
QERIAIHKFTTALKATGLQTSDPRLRDCMSQMRRMVRESSSGGLLDRDLFRKCVSSNIVL
LTQAFRKKFVIPDFEEFKDHVDRIFEETKERTGGKVAAYIPQLAKSDPDLWGVSLCTVDG
QRHSVGHTKIPFCLQSCVKPLTYAISVSNLGTEYVHKYVGKEPSGLRYNKLSLNEEGIPH
NPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAGNEYMGFSNATFQSEKETGDRNYA
IGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESGSVMAATLANGGICPITGESVLTA
EAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGAILLVVPNVMGLMCLSPPLDKVGN
SHRGISFCQKLVSLFNFHNYDNLRHCAKKLDPRREGGEVRNKTVVNLLFAAYSGDVSALR
RFALSAMDMEQKDYDSRTALHVAAAEGHLEVVKFLVEACKVNPFVKDRWGNIPLDDAVQF
NHLEVVRLLRDYQESYTLSDPRVEIAAEALSKENLESMV
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgcccttgccttgggatttgggggtttgggtccgaccaactcgggctatcttccggggt
ccttcgggacggggcttgagtcacattgacccttcggaatgtacggctgcaagtgattca
tcagagagtggcatgctgtcccgcctgggtgacctgctcttctacaccattgctgaggga
caagaaaggatcgccatccataagttcaccactgcgctgaaagccaccgggctgcagaca
tcagatcccaggcttcgggactgtatgagccagatgcgacggatggttcgagaatctagc
agtgggggtctcttagaccgtgatctctttaggaagtgtgtgagcagcaacattgtgctg
ctgacccaggcgttccgaaagaagtttgtcattccggactttgaggagttcaaggaccat
gtggatcggatctttgaggagaccaaagagcgcacaggaggcaaggtggcagcctacatt
ccccagctagccaagtcggatcctgacctctggggtgtctcactatgcaccgtggatggg
caaaggcactcagtaggacacactaagattcccttctgtctacagtcctgtgtgaagccc
ctcacttacgccatatctgtcagcaacctgggcactgagtatgtgcataaatatgtgggc
aaagagcccagtggtctacggtacaacaagctttccctcaatgaggaaggaatccctcat
aatccaatggtcaatgctggtgccattgttgtgagttccctaataaagatggactgcaat
aaagcggagaagtttgattttgtattgcagtatctgaacaaaatggcaggaaatgaatat
atgggtttcagcaatgctacgttccaatcggaaaaagaaaccggggatcgcaattatgcc
attggctattatctcaaggagaagaagtgttttcctaagggagttgacatgatggctgca
ttggacctctacttccagctgtgctcagtggaggtgacatgtgaatccggcagcgtcatg
gcggccacgctggccaatggcggaatctgccctatcacgggcgagagcgtgctcacggcc
gaggctgttcgcaacaccctcagcctcatgcattcctgtggcatgtatgatttctctgga
cagtttgccttccatgtgggccttccagccaagtcggccgtgtcaggagccatcctgctc
gtggtacccaacgtcatggggttgatgtgcctgtcccctccgctagataaggtgggcaac
agccacaggggcatcagcttctgccagaagctagtctcgctcttcaacttccataactac
gacaacctgcggcactgtgctaagaaactggatccgagacgggaaggaggagaagtccgg
aacaagactgtggtgaacctgctatttgctgcctacagtggagatgtttcagctcttcga
aggtttgccttgtcagccatggacatggaacagaaggactatgactcccgcacagctctc
catgtcgctgccgcagaaggacatttagaagttgtcaagttcctggtggaagcctgcaaa
gtaaatcctttcgtgaaggacaggtggggcaacattcccctggatgatgctgtgcaattc
aaccatctggaagtggtcaggctgcttcgggactaccaagagtcctacactttgtctgat
ccacgggttgagatagcagctgaagccctgtctaaagaaaatctggaaagcatggtgtaa

DBGET integrated database retrieval system