KEGG   Monodelphis domestica (opossum): 100024675Help
Entry
100024675         CDS       T01031                                 

Gene name
RARB
Definition
retinoic acid receptor, beta
Orthology
K08528  
retinoic acid receptor beta
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Pathways in cancer
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100024675 (RARB)
   05222 Small cell lung cancer
    100024675 (RARB)
   05223 Non-small cell lung cancer
    100024675 (RARB)
Transcription factors [BR:mdo03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    100024675 (RARB)
Nuclear receptors [BR:mdo03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   100024675 (RARB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 517 aa AA seqDB search
MTIRINYRLLAVLSVIIHDSGLGKGPAARRAKNGAELDGVGWTSPVPPASPPLEEKALLQ
TFCRERGEIMFDCMDVLAVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQRRHTA
QSIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQK
NMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDKNKKKKEPSKQEFTESY
EMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIK
IVEFAKRLPGFTSLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMH
NAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEA
LKIYIRKRRPNKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSE
GHEPLTPSSSGNTAEHSPSISPSSVENSGVGQSPLVQ
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaccattcggatcaattacaggcttttagcggtgttgtctgtcataattcatgattcg
ggtctgggaaaaggaccagcagcccggcgtgccaagaacggggcagagttggatggagtt
gggtggacttctcccgtgcctcctgcctctccgcccctagaggagaaagcacttttgcag
acattctgtagagagaggggagagatcatgtttgactgtatggatgttctcgcagtgagc
cctgggcaaatcctggacttctatactgcgagcccgtcttcttgcatgctccaggagaaa
gcgctcaaagcatgcttcagtggattgacacaaacagagtggcaacgccggcacactgct
caatccatcgaaacacagagtaccagttctgaggagctcgtccccagccccccttctcca
ctccctcctcctcgggtttacaagccttgttttgtgtgtcaggacaagtcatcgggctat
cactatggagtcagcgcttgtgagggatgtaagggctttttccgcagaagtattcagaag
aacatgatttacacttgccaccgagataagaactgtgtgattaacaaagtcaccaggaac
cgctgccagtactgccgactccagaaatgctttgaagtggggatgtccaaagaatctgtc
agaaatgataagaataaaaagaagaaagaaccttcaaagcaggaattcacagaaagctat
gaaatgacagcagaattggatgatctcaccgaaaagatccggaaagctcatcaggaaacc
ttcccatctctctgccagctgggaaaatataccacgaattccagcgctgatcatcgggtg
cgcctggacctgggcctctgggacaagttcagtgagctggccacaaagtgcattattaaa
attgtggagtttgcgaaaaggctgcctggcttcaccagtttgaccatcgcggatcagatc
accctcctgaaggcagcctgcctggacatcttgattcttagaatctgcacaagatacacc
cccgaacaagacacgatgactttctccgacggccttaccctgaaccgaacccagatgcac
aatgccggctttggacccctcaccgatctggtgttcacctttgccaatcagctcctgcct
ttggaaatggatgatacagaaacaggccttcttagtgccatctgcttaatctgtggagac
cgtcaggaccttgaagaaccaacaaaagtggataagctacaagaaccattgctggaagcc
ctgaagatttacatcagaaagagacgccccaacaagcctcacatgtttccaaagatcctt
atgaaaatcacagatctccgcagcattagtgcaaaaggtgcagaacgtgtgattacattg
aagatggaaatccccggctcaatgccccccctcattcaggaaatgctggagaattccgaa
ggacatgaacccctgaccccaagctccagtggcaatacagcagagcacagtcctagcatc
tcacccagctccgtggagaacagtggggtcggccagtccccactggtgcaataa

DBGET integrated database retrieval system