KEGG   Monodelphis domestica (opossum): 100024682Help
Entry
100024682         CDS       T01031                                 

Definition
d-amino-acid oxidase-like
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mdo00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mdo00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:mdo00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis
Cellular Processes; Transport and catabolism; Peroxisome [PATH:mdo04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 345 aa AA seqDB search
MNVAVIGAGVIGLSTALCLHEHYHHTLRPLSIKVYADRFTPLTTSDGAAGFWQPYLSEDP
QERAWNQKTFDYLLGYLGSPEAKKMGLFLLSGYNLFPKAVPDPSWKDTVLGFRKLTPREL
ELFPGYSYGWINTSMILEAKSYLPWLTQRLTERGVKFFQRKVHSFEEVAREGADVIINCT
GVWAGELQADPLLQPGRGQILKVLAPWVKHFIVTHSEDAGIYKTPYIIPGSQTVTLGGIF
QLGNWNEKSDAQDHNTIWEGCCRLEPTLREADIMYTWSGFRPIRSQIRLEREKLSHGPFK
AEIIHNYGHGGYGLTIHWGCALEAAKLFGQILEERKLPNIPPSHL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtggctgtgattggggcaggcgtgattggactttccactgccctgtgcctccat
gagcattaccaccacaccctgcggcccctgtccatcaaggtgtacgctgaccgctttaca
cccctcacaaccagtgatggggctgctggtttctggcagccctacctctcagaggaccca
caggagagggcttggaatcaaaagacctttgactacctactgggctaccttggctctccg
gaagccaagaaaatgggccttttcctcctctcaggatacaacctcttccccaaagctgtc
ccggatccctcctggaaggacacggttctgggatttcggaaactaaccccgcgggagctt
gagctgtttcctggctacagctatggctggatcaatacttcgatgatcctggaagccaag
agctacctgccatggcttacccagaggttaactgaacggggagtcaagttcttccagaga
aaagtccattcctttgaggaggtggcaagagaaggggcagacgtgatcatcaattgcact
ggagtgtgggctggggagctgcaggctgaccccttgctgcagcccggacggggacagatc
ctcaaggtcttggccccttgggtgaaacacttcattgtcactcacagtgaagatgctggg
atctacaagaccccctatatcattccagggagccagacagtgactctgggtggcatcttt
caattggggaactggaatgaaaagagcgatgcccaggaccacaatacaatttgggaaggc
tgctgccgcttggagcccacacttcgggaggcagacatcatgtatacatggagtggtttc
cggccaatccggtcccaaatccggctggagagagagaagctgtctcatgggcccttcaag
gcagagatcattcataactatggccatggtggttatggactcaccatccattggggctgt
gccttggaggctgccaagctctttgggcaaatcctagaagaaaggaagctgcccaatatt
cctccatcccacctctga

DBGET integrated database retrieval system