KEGG   Monodelphis domestica (opossum): 100024908Help
Entry
100024908         CDS       T01031                                 

Gene name
USP12, USP12P1
Definition
ubiquitin specific peptidase 12
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100024908 (USP12)
Peptidases [BR:mdo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100024908 (USP12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 370 aa AA seqDB search
MEILMTVSKFASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFC
RPFREKVLAYKSQPRKKENLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNY
MQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDSENNNSTPDPTWVHEIFQGTL
TNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQ
EAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMY
DLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSES
GYILFYQSRD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcctaatgacagtctccaaatttgcttccatctgtaccatgggcgccaatgcc
tcggctttagagaaagagattggtccagaacagtttccagtcaatgaacactattttgga
ttagtcaattttggaaacacctgctactgcaattcagttcttcaagcactttatttttgc
cgtccatttcgagaaaaagttctagcttacaagagtcaacctaggaagaaagagaatctt
cttacgtgcttagcagatctctttcacagtatagccactcagaagaaaaaggttggagta
atacctcctaagaagttcataacaaggttacgaaaagaaaatgaactttttgacaactac
atgcagcaagatgcacatgagtttttgaattacctactaaatacaattgctgatatttta
caagaagagagaaagcaggaaaagcagaatggtcgtctacctaatggcaatattgacagt
gaaaataacaacagcacaccagacccaacttgggttcatgagatctttcagggaacatta
actaatgaaaccagatgtcttacttgtgaaactataagtagcaaagatgaagatttttta
gacctttctgttgatgtggaacaaaacacatcaattactcactgcttaaggggttttagc
aacacagaaactctatgcagtgaatacaaatattactgcgaagaatgtcgcagcaaacag
gaagcacacaaaaggatgaaagtaaaaaaactgcccatgattttggcactgcacttgaag
agatttaaatatatggatcagcttcatcgatacacaaaactttcttatcgggtagttttt
cctttagaacttcgactatttaacacttcaggagatgccaccaatcctgacagaatgtat
gaccttgttgctgttgtggttcactgtggaagtggtcctaatcgaggccattacattgca
attgttaagagtcatgatttttggttattgtttgatgatgacattgtagagaaaatagat
gcacaagctattgaagaattctacgggttgacatcagacatctcaaagaactctgagtct
ggttacatcctcttctatcagtctcgggactga

DBGET integrated database retrieval system