KEGG   Monodelphis domestica (opossum): 100025069Help
Entry
100025069         CDS       T01031                                 

Gene name
HAT1
Definition
histone acetyltransferase 1
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Alcoholism
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Human Diseases
  Substance dependence
   05034 Alcoholism
    100025069 (HAT1)
Enzymes [BR:mdo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100025069 (HAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 419 aa AA seqDB search
MAGFGAVEKFLVEYKSAMEKKLAEYKCNTNEAIQLKLVRFAEDIDNDSTTFNPEYSHQIF
GDDETVFGYKGLKIILYYNAGNLSTLFRIEYASKVSENFDCVEADDVESKIREIIPPGFY
TNTDDFVSLLEKEVNFKPFGTLLHTYSVHNKEAGENITYEIYKADMTCTGFREYHERLQT
FLMWFIETASFIDVDDERWNYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQ
MLILPPFQGEGHGAQLFETVHRYYISSPIVLDITAEDPSENYVKLRDFVLVKLCQDLPCF
SPDKLMQGFSQDMVTEAQQKLKINKQHARRVYEILRLRVTDMGDAEQSRGYRLDIKRRLI
GPYKKKQRDLAKMRRCLRPEELTNQMNQIDISMQHEQLEESFQQLVSDYRRIIERLAQA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcgggatttggtgcagtggaaaaatttctagtggagtataagagtgctatggagaag
aagctggcagagtacaagtgtaacaccaatgaagcaattcaacttaaattagttcgcttt
gctgaggatattgacaatgacagcacaacttttaatcctgaatacagccatcaaatattt
ggggatgatgaaactgtctttggttacaagggccttaagatcattttgtactataatgct
ggtaacctgtcaacactgtttcgaattgaatatgcatctaaagttagtgaaaatttcgac
tgtgtagaggcagatgatgttgagagcaaaattagagaaatcattcctccaggattttat
acaaacacagatgattttgtttcattgttggaaaaggaagttaattttaagccctttggc
acattactccatacatactcagttcacaataaagaagcaggagaaaatattacctatgaa
atatacaaggctgacatgacatgtacaggctttcgagaatatcatgaaaggcttcagacc
tttttgatgtggtttattgaaactgctagctttattgacgtggatgatgaaagatggaac
tactttctagtatttgagaagtataataaggatggagctacgctctttgcgaccgtaggc
tacatgacagtctataattactatgtgtacccagacaaaacccggccacgtgtaagccag
atgttgatattgcctccatttcaaggtgaaggccatggtgcccaactttttgaaactgtt
catagatattatatatcttctcctattgttcttgatattacagctgaagatccatctgaa
aactatgtgaaactaagagattttgtacttgtgaagctttgccaagatctgccttgcttt
tcaccagacaagttaatgcaaggattcagtcaagatatggtgacagaggcacaacagaag
ctcaaaataaataagcaacatgctaggcgagtttatgaaatcctccggttacgtgtgact
gacatgggtgatgctgaacaatccagaggctatagactggacataaaaagaagattaatt
ggtccatataagaaaaagcagagagatcttgccaagatgagaagatgtctcaggcctgaa
gagttgacaaaccagatgaaccaaatagacataagcatgcaacatgaacagttggaggaa
agcttccagcaacttgtttcagactacagaagaataatagaacgacttgctcaagcataa

DBGET integrated database retrieval system